Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Common timothy
Uniprot ID:
P43214
Molecular weight:
13.11 kDa

Original price was: €276.00.Current price is: €228.00.

50ug 17% OFF + 228 loyalty points
His Val27–Glu122
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His

Product name ARO-P15607-100
Uniprot ID P43214
Origin species Common timothy
Expression system Prokaryotic expression
Raw Antigen Sequence VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Molecular weight 13.11 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val27-Glu122
Aliases /Synonyms Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Reference ARO-P15607
Note For research use only.
Molecular Constructor
His Val27–Glu122
Product name ARO-P15607-1MG
Uniprot ID P43214
Origin species Common timothy
Expression system Prokaryotic expression
Raw Antigen Sequence VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Molecular weight 13.11 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val27-Glu122
Aliases /Synonyms Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Reference ARO-P15607
Note For research use only.
Molecular Constructor
His Val27–Glu122
Product name ARO-P15607-50
Uniprot ID P43214
Origin species Common timothy
Expression system Prokaryotic expression
Raw Antigen Sequence VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Molecular weight 13.11 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val27-Glu122
Aliases /Synonyms Pollen allergen Phl p 2, Allergen Phl p II, Phl p 2, PHLPII
Reference ARO-P15607
Note For research use only.
Molecular Constructor
His Val27–Glu122

There are no reviews yet.

Be the first to review “Recombinant Phleum pratense PHLPII/Phl p 2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products