Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mycoplasma pneumoniae HMW3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mycoplasma pneumoniae
Uniprot ID:
Q50360
Molecular weight:
32.04 kDa

Original price was: €290.00.Current price is: €228.00.

50ug 21% OFF + 228 loyalty points
His-SUMO Pro160–Glu339
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mycoplasma pneumoniae HMW3 Protein, N-His-SUMO

Product name ARO-P15837-100
Uniprot ID Q50360
Origin species Mycoplasma pneumoniae
Expression system Prokaryotic expression
Raw Antigen Sequence PVVDPDATPEQQADQLFGLDPLPQAPDEYQDTTAPPAYDQTFDQATYDQQAYDQNYDPNAYYDQQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPLQPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVE
Molecular weight 32.04 kDa
Protein delivered with Tag? N-Terminal His-SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro160-Glu339
Aliases /Synonyms Cytadherence high molecular weight protein 3, Accessory adhesin protein 3, Cytadherence accessory protein 3, hmw3, MPN_452, MP389
Reference ARO-P15837
Note For research use only.
Molecular Constructor
His-SUMO Pro160–Glu339
Product name ARO-P15837-1MG
Uniprot ID Q50360
Origin species Mycoplasma pneumoniae
Expression system Prokaryotic expression
Raw Antigen Sequence PVVDPDATPEQQADQLFGLDPLPQAPDEYQDTTAPPAYDQTFDQATYDQQAYDQNYDPNAYYDQQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPLQPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVE
Molecular weight 32.04 kDa
Protein delivered with Tag? N-Terminal His-SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro160-Glu339
Aliases /Synonyms Cytadherence high molecular weight protein 3, Accessory adhesin protein 3, Cytadherence accessory protein 3, hmw3, MPN_452, MP389
Reference ARO-P15837
Note For research use only.
Molecular Constructor
His-SUMO Pro160–Glu339
Product name ARO-P15837-50
Uniprot ID Q50360
Origin species Mycoplasma pneumoniae
Expression system Prokaryotic expression
Raw Antigen Sequence PVVDPDATPEQQADQLFGLDPLPQAPDEYQDTTAPPAYDQTFDQATYDQQAYDQNYDPNAYYDQQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPLQPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVE
Molecular weight 32.04 kDa
Protein delivered with Tag? N-Terminal His-SUMO Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro160-Glu339
Aliases /Synonyms Cytadherence high molecular weight protein 3, Accessory adhesin protein 3, Cytadherence accessory protein 3, hmw3, MPN_452, MP389
Reference ARO-P15837
Note For research use only.
Molecular Constructor
His-SUMO Pro160–Glu339

There are no reviews yet.

Be the first to review “Recombinant Mycoplasma pneumoniae HMW3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products