Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse YTHDF2/HGRG8, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q91YT7
Molecular weight:
89.07 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met1–Lys579
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse YTHDF2/HGRG8, N-GST

Product name ARO-P12888-100
Uniprot ID Q91YT7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASSVPKVVGSAVGSGSITSNIVASSSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Molecular weight 89.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys579
Aliases /Synonyms YTH domain-containing family protein 2, High-glucose-regulated protein 8, Renal carcinoma antigen NY-REN-2, DF2, HGRG8, YTHDF2, CLL-associated antigen KW-14
Reference ARO-P12888
Note For research use only.
Molecular Constructor
Met1–Lys579
Product name ARO-P12888-1MG
Uniprot ID Q91YT7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASSVPKVVGSAVGSGSITSNIVASSSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Molecular weight 89.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys579
Aliases /Synonyms YTH domain-containing family protein 2, High-glucose-regulated protein 8, Renal carcinoma antigen NY-REN-2, DF2, HGRG8, YTHDF2, CLL-associated antigen KW-14
Reference ARO-P12888
Note For research use only.
Molecular Constructor
Met1–Lys579
Product name ARO-P12888-50
Uniprot ID Q91YT7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASSVPKVVGSAVGSGSITSNIVASSSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Molecular weight 89.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys579
Aliases /Synonyms YTH domain-containing family protein 2, High-glucose-regulated protein 8, Renal carcinoma antigen NY-REN-2, DF2, HGRG8, YTHDF2, CLL-associated antigen KW-14
Reference ARO-P12888
Note For research use only.
Molecular Constructor
Met1–Lys579

Recombinant Mouse YTHDF2/HGRG8 is a protein that plays a crucial role in the regulation of gene expression through its interaction with RNA molecules. It is a member of the YTH domain-containing family of proteins, which are characterized by their ability to bind to specific RNA sequences and regulate various cellular processes. In this article, we will explore the structure, activity, and applications of Recombinant Mouse YTHDF2/HGRG8.

Structure of Recombinant Mouse YTHDF2/HGRG8

Recombinant Mouse YTHDF2/HGRG8 is a 30-kDa protein consisting of 276 amino acids. It contains a conserved YTH domain, which is responsible for its RNA-binding activity. This domain is characterized by a conserved aromatic residue that plays a crucial role in recognizing specific RNA sequences. In addition to the YTH domain, Recombinant Mouse YTHDF2/HGRG8 also contains a proline-rich region and a C-terminal domain, which are involved in protein-protein interactions.

Activity of Recombinant Mouse YTHDF2/HGRG8

Recombinant Mouse YTHDF2/HGRG8 is primarily known for its role in the regulation of gene expression through its interaction with RNA molecules. It specifically recognizes and binds to m6A-modified RNA, which is a common modification found in eukaryotic mRNA. This binding leads to the recruitment of various RNA-binding proteins and enzymes, which ultimately affect the stability, translation, and localization of the targeted RNA molecules.

In addition to its role in gene expression, Recombinant Mouse YTHDF2/HGRG8 has also been shown to play a role in other cellular processes. It has been implicated in the regulation of cell proliferation, apoptosis, and stress response. It has also been found to interact with viral RNA and play a role in viral infection.

Applications of Recombinant Mouse YTHDF2/HGRG8

Recombinant Mouse YTHDF2/HGRG8 has a wide range of applications in both basic research and therapeutic development. Its ability to specifically bind to m6A-modified RNA makes it a valuable tool for studying the role of this modification in gene expression. It can also be used to investigate the function of specific m6A-modified RNA molecules and their interaction with other proteins.

In addition, Recombinant Mouse YTHDF2/HGRG8 has potential therapeutic applications. As it plays a role in regulating cell proliferation and apoptosis, it could be targeted for the treatment of various cancers. Its ability to interact with viral RNA also makes it a potential target for antiviral therapies.

Moreover, Recombinant Mouse YTHDF2/HGRG8 can be used to develop diagnostic tools for diseases that involve dysregulation of m6A-modified RNA. By detecting the levels of this protein in patient samples, it could serve as a biomarker for various diseases.

Conclusion

In conclusion, Recombinant Mouse YTHDF2/HGRG8 is a crucial protein involved in the regulation of gene expression through its interaction with RNA molecules. Its structure, activity, and applications make it a valuable tool for studying various cellular processes and have potential therapeutic and diagnostic applications. Further research on this protein could provide valuable insights into the role of m6A-modified RNA in health and disease.

Recombinant Mouse YTHDF2/HGRG8, N-GST

There are no reviews yet.

Be the first to review “Recombinant Mouse YTHDF2/HGRG8, N-GST”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products