Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse MECOM Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P14404
Molecular weight:
16.03 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
His Asp74–Ser193
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse MECOM Protein, N-His

Product name ARO-P16388-100
Uniprot ID P14404
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLKDSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKS
Molecular weight 16.03 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp74-Ser193
Aliases /Synonyms Histone-lysine N-methyltransferase MECOM, 2.1.1.367, Ecotropic virus integration site 1 protein, EVI-1, MDS1 and EVI1 complex locus protein, Myelodysplasia syndrome 1 protein homolog, Mecom, Evi1, Mds1, Prdm3
Reference ARO-P16388
Note For research use only.
Molecular Constructor
His Asp74–Ser193
Product name ARO-P16388-1MG
Uniprot ID P14404
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLKDSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKS
Molecular weight 16.03 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp74-Ser193
Aliases /Synonyms Histone-lysine N-methyltransferase MECOM, 2.1.1.367, Ecotropic virus integration site 1 protein, EVI-1, MDS1 and EVI1 complex locus protein, Myelodysplasia syndrome 1 protein homolog, Mecom, Evi1, Mds1, Prdm3
Reference ARO-P16388
Note For research use only.
Molecular Constructor
His Asp74–Ser193
Product name ARO-P16388-50
Uniprot ID P14404
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLKDSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKS
Molecular weight 16.03 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp74-Ser193
Aliases /Synonyms Histone-lysine N-methyltransferase MECOM, 2.1.1.367, Ecotropic virus integration site 1 protein, EVI-1, MDS1 and EVI1 complex locus protein, Myelodysplasia syndrome 1 protein homolog, Mecom, Evi1, Mds1, Prdm3
Reference ARO-P16388
Note For research use only.
Molecular Constructor
His Asp74–Ser193

There are no reviews yet.

Be the first to review “Recombinant Mouse MECOM Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products