Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse JAG2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9QYE5
Molecular weight:
21.41 kDa

Original price was: €299.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Met27–Asn201
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse JAG2 Protein, N-His

Product name ARO-P10453-100
Uniprot ID Q9QYE5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTPTGPCSYGYGATPVLGGNSFYLPPAGAAGDRARARSRTGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDEN
Molecular weight 21.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met27-Asn201
Aliases /Synonyms Protein jagged-2, hJ2, Jagged2, JAG2
Reference ARO-P10453
Note For research use only.
Molecular Constructor
Met27–Asn201
Product name ARO-P10453-1MG
Uniprot ID Q9QYE5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTPTGPCSYGYGATPVLGGNSFYLPPAGAAGDRARARSRTGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDEN
Molecular weight 21.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met27-Asn201
Aliases /Synonyms Protein jagged-2, hJ2, Jagged2, JAG2
Reference ARO-P10453
Note For research use only.
Molecular Constructor
Met27–Asn201
Product name ARO-P10453-50
Uniprot ID Q9QYE5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTPTGPCSYGYGATPVLGGNSFYLPPAGAAGDRARARSRTGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDEN
Molecular weight 21.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met27-Asn201
Aliases /Synonyms Protein jagged-2, hJ2, Jagged2, JAG2
Reference ARO-P10453
Note For research use only.
Molecular Constructor
Met27–Asn201

The Structure and Function of Recombinant Mouse JAG2 Protein

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the gene for a specific protein is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the desired protein. One such recombinant protein is Recombinant Mouse JAG2 Protein, which is a key signaling molecule involved in various cellular processes. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse JAG2 Protein.

Structure of Recombinant Mouse JAG2 Protein

Recombinant Mouse JAG2 Protein is a transmembrane protein that belongs to the Notch signaling pathway. It is a member of the Jagged/Serrate family of proteins, which are known to play important roles in cell fate determination and tissue development. The protein is composed of 1246 amino acids and has a molecular weight of approximately 140 kDa. It consists of an extracellular domain, a transmembrane domain, and an intracellular domain.

The extracellular domain of Recombinant Mouse JAG2 Protein contains a DSL (Delta, Serrate, Lag-2) domain, which is essential for binding to the Notch receptor. It also has multiple EGF-like repeats, which are involved in protein-protein interactions. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain contains a C-terminal PDZ-binding motif, which is important for protein-protein interactions and signaling.

Activity of Recombinant Mouse JAG2 Protein

Recombinant Mouse JAG2 Protein is a ligand for the Notch receptor, which is a transmembrane protein found on the surface of various cell types. When the extracellular domain of JAG2 binds to the Notch receptor, it triggers a series of proteolytic cleavages that release the intracellular domain of the Notch receptor. This intracellular domain then translocates to the nucleus, where it regulates the expression of target genes involved in cell differentiation, proliferation, and survival.

In addition to its role in the Notch signaling pathway, Recombinant Mouse JAG2 Protein has also been shown to interact with other signaling pathways, such as the Wnt and TGF-β pathways. It has been reported to play a role in cell migration, adhesion, and angiogenesis. Studies have also shown that Recombinant Mouse JAG2 Protein is involved in the development of various tissues and organs, including the heart, brain, and immune system.

Applications of Recombinant Mouse JAG2 Protein

Recombinant Mouse JAG2 Protein has a wide range of applications in both basic research and therapeutic development. Due to its role in cell fate determination and tissue development, it is commonly used in studies related to embryonic development, stem cell biology, and tissue regeneration. Recombinant Mouse JAG2 Protein is also used in cancer research, as the Notch signaling pathway has been implicated in the development and progression of various cancers.

In addition, Recombinant Mouse JAG2 Protein has potential therapeutic applications. It has been shown to have anti-inflammatory effects and has been investigated as a potential treatment for inflammatory diseases, such as rheumatoid arthritis. It has also been studied as a potential therapy for heart disease, as it has been shown to promote cardiac regeneration and repair.

Conclusion

Recombinant Mouse JAG2 Protein is a key signaling molecule that plays important roles in cell fate determination, tissue development, and disease processes. Its structure, activity, and applications make it a valuable tool for studying various cellular processes and developing potential therapies. With ongoing research, we can gain a better understanding of the role of Recombinant Mouse JAG2 Protein in various biological processes and potentially harness its therapeutic potential.

Recombinant Mouse JAG2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse JAG2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products