Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse GFAP Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P03995
Molecular weight:
14.64 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Thr107–Glu210
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse GFAP Protein, N-His

Product name ARO-P10615-100
Uniprot ID P03995
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELRE
Molecular weight 14.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr107-Glu210
Aliases /Synonyms GFAP, Glial fibrillary acidic protein
Reference ARO-P10615
Note For research use only.
Molecular Constructor
Thr107–Glu210
Product name ARO-P10615-1MG
Uniprot ID P03995
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELRE
Molecular weight 14.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr107-Glu210
Aliases /Synonyms GFAP, Glial fibrillary acidic protein
Reference ARO-P10615
Note For research use only.
Molecular Constructor
Thr107–Glu210
Product name ARO-P10615-50
Uniprot ID P03995
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLARVDLERKVESLEEEIQFLRKIYEEEVRELRE
Molecular weight 14.64 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr107-Glu210
Aliases /Synonyms GFAP, Glial fibrillary acidic protein
Reference ARO-P10615
Note For research use only.
Molecular Constructor
Thr107–Glu210

Introduction to Recombinant Mouse GFAP Protein

Recombinant Mouse GFAP Protein, also known as Glial Fibrillary Acidic Protein, is a type of recombinant protein that plays a crucial role in the structure and function of the central nervous system. It is a major component of astrocytes, a type of glial cell that provides support and protection to neurons in the brain and spinal cord. Recombinant Mouse GFAP Protein is widely used in scientific research and has a variety of applications in the field of neurobiology. In this article, we will explore the structure, activity, and applications of this important protein.

Structure of Recombinant Mouse GFAP Protein

Recombinant Mouse GFAP Protein is a type III intermediate filament protein, meaning it is a long, fibrous protein that provides structural support to cells. It is composed of a central rod domain, a head domain, and a tail domain. The rod domain is made up of four alpha-helical segments that are connected by non-helical linker regions. This structure allows the protein to form long, flexible filaments that can withstand mechanical stress and provide support to cells.

The head and tail domains of Recombinant Mouse GFAP Protein are responsible for its interactions with other proteins and cellular components. The head domain contains binding sites for other intermediate filament proteins, while the tail domain contains binding sites for cytoskeletal proteins and enzymes.

Activity of Recombinant Mouse GFAP Protein

The main function of Recombinant Mouse GFAP Protein is to provide structural support to astrocytes in the central nervous system. Astrocytes are essential for maintaining the health and function of neurons, and Recombinant Mouse GFAP Protein plays a critical role in this process. It forms a network of filaments that support the shape and integrity of astrocytes, allowing them to perform their various functions.

In addition to its structural role, Recombinant Mouse GFAP Protein has also been shown to play a role in cell signaling and regulation. It has been found to interact with various signaling molecules and enzymes, and its expression can be regulated by certain hormones and growth factors. This suggests that Recombinant Mouse GFAP Protein may have a broader role in cellular processes beyond its structural function.

Applications of Recombinant Mouse GFAP Protein

Recombinant Mouse GFAP Protein has a wide range of applications in the field of neurobiology. One of its most common uses is as an antigen in immunohistochemistry and immunofluorescence studies. Its specific expression in astrocytes makes it a useful marker for identifying and studying these cells in tissue samples.

In addition, Recombinant Mouse GFAP Protein has been used in studies on the role of astrocytes in brain development and disease. Its ability to form filaments and interact with other proteins makes it a valuable tool for investigating the structure and function of astrocytes in various neurological conditions.

Furthermore, Recombinant Mouse GFAP Protein has potential therapeutic applications. It has been studied as a potential target for treatments of neurodegenerative diseases such as Alzheimer’s and Parkinson’s. Its role in cell signaling and regulation also makes it a promising candidate for drug development.

Conclusion

In conclusion, Recombinant Mouse GFAP Protein is a crucial protein in the central nervous system, playing a key role in the structure and function of astrocytes. Its unique structure and activity make it a valuable tool for scientific research and have led to a wide range of applications in the field of neurobiology. Further studies on this protein may provide insights into the development and treatment of various neurological conditions.

Recombinant Mouse GFAP Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse GFAP Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products