Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FZD5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9EQD0
Molecular weight:
38.51 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Thr37–Ala126
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FZD5 Protein, N-GST & C-His

Product name ARO-P10469-100
Uniprot ID Q9EQD0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFA
Molecular weight 38.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr37-Ala126
Aliases /Synonyms Frizzled-5, FzE5, C2orf31, hFz5, FZD5, Fz-5
Reference ARO-P10469
Note For research use only.
Molecular Constructor
Thr37–Ala126
Product name ARO-P10469-1MG
Uniprot ID Q9EQD0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFA
Molecular weight 38.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr37-Ala126
Aliases /Synonyms Frizzled-5, FzE5, C2orf31, hFz5, FZD5, Fz-5
Reference ARO-P10469
Note For research use only.
Molecular Constructor
Thr37–Ala126
Product name ARO-P10469-50
Uniprot ID Q9EQD0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFA
Molecular weight 38.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr37-Ala126
Aliases /Synonyms Frizzled-5, FzE5, C2orf31, hFz5, FZD5, Fz-5
Reference ARO-P10469
Note For research use only.
Molecular Constructor
Thr37–Ala126

Recombinant Mouse FZD5 Protein: Structure, Activity, and Application

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the DNA sequence encoding the protein is inserted into an expression vector and then expressed in a host organism. Recombinant proteins have become essential tools in various fields of research, including biotechnology, medicine, and drug development. One such protein is the Recombinant Mouse FZD5 Protein, which has gained significant attention due to its role in the Wnt signaling pathway and its potential therapeutic applications.

Structure of Recombinant Mouse FZD5 Protein

The FZD5 protein is a member of the Frizzled family of transmembrane receptors, which are involved in the transduction of Wnt signaling. The recombinant mouse FZD5 protein is a 68 kDa protein composed of 533 amino acids. It contains a seven-transmembrane domain, a cysteine-rich domain, and a PDZ-binding motif. The recombinant protein also contains a FLAG tag at the N-terminus, which allows for easy detection and purification.

Activity of Recombinant Mouse FZD5 Protein

The primary function of FZD5 protein is to bind to Wnt ligands and initiate the Wnt signaling cascade. The recombinant mouse FZD5 protein has been shown to exhibit similar activity to the native protein in binding to Wnt ligands and activating downstream signaling pathways. It has also been demonstrated to interact with other proteins in the Wnt signaling pathway, such as LRP5/6 and DVL, to regulate cell proliferation, differentiation, and migration.

Application of Recombinant Mouse FZD5 Protein

The recombinant mouse FZD5 protein has various applications in both research and therapeutic settings. One of its primary uses is in studying the Wnt signaling pathway and its role in development, homeostasis, and disease. The recombinant protein can be used in biochemical and cell-based assays to investigate the interaction between FZD5 and other proteins in the pathway and to screen for potential inhibitors or activators of the pathway.

Additionally, the recombinant FZD5 protein has shown promise in therapeutic applications. Aberrant activation of the Wnt signaling pathway has been implicated in various diseases, including cancer and osteoporosis. As FZD5 is a key player in this pathway, the recombinant protein can be used as a therapeutic target to develop drugs that can modulate its activity. Furthermore, the recombinant protein can also be used in gene therapy approaches to deliver FZD5 to specific tissues or cells to correct Wnt signaling dysregulation.

Conclusion

The recombinant mouse FZD5 protein is a crucial tool in understanding the Wnt signaling pathway and its role in various biological processes. Its well-defined structure and similar activity to the native protein make it a reliable and versatile protein for research and therapeutic applications. As research in this field continues to advance, the recombinant FZD5 protein will undoubtedly play a vital role in uncovering the complexities of the Wnt signaling pathway and its potential for therapeutic intervention.

Recombinant Mouse FZD5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse FZD5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products