Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CLEC6A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JKF4
Molecular weight:
21.78 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points
Ile44–Leu209
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CLEC6A Protein, N-His

Product name ARO-P10460-100
Uniprot ID Q9JKF4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
Molecular weight 21.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile44-Leu209
Aliases /Synonyms DC-associated C-type lectin 2, DECTIN2, Dendritic cell-associated C-type lectin 2, CLECSF10, CLEC6A, C-type lectin domain family 6 member A, C-type lectin superfamily member 10, Dectin-2
Reference ARO-P10460
Note For research use only.
Molecular Constructor
Ile44–Leu209
Product name ARO-P10460-1MG
Uniprot ID Q9JKF4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
Molecular weight 21.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile44-Leu209
Aliases /Synonyms DC-associated C-type lectin 2, DECTIN2, Dendritic cell-associated C-type lectin 2, CLECSF10, CLEC6A, C-type lectin domain family 6 member A, C-type lectin superfamily member 10, Dectin-2
Reference ARO-P10460
Note For research use only.
Molecular Constructor
Ile44–Leu209
Product name ARO-P10460-50
Uniprot ID Q9JKF4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
Molecular weight 21.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile44-Leu209
Aliases /Synonyms DC-associated C-type lectin 2, DECTIN2, Dendritic cell-associated C-type lectin 2, CLECSF10, CLEC6A, C-type lectin domain family 6 member A, C-type lectin superfamily member 10, Dectin-2
Reference ARO-P10460
Note For research use only.
Molecular Constructor
Ile44–Leu209

Introduction

Recombinant proteins have become invaluable tools in various fields of research and medicine due to their ability to mimic naturally occurring proteins and perform specific functions. One such protein is the Recombinant Mouse CLEC6A protein, which has gained attention for its potential role in immune response and disease treatment. In this article, we will explore the structure, activity, and applications of this protein in detail.

Structure of Recombinant Mouse CLEC6A Protein

The C-type lectin domain family 6 member A (CLEC6A) protein, also known as Dectin-2, is a type II transmembrane protein that is encoded by the CLEC6A gene in mice. It is composed of a single polypeptide chain of 254 amino acids and has a molecular weight of approximately 29 kDa. The protein consists of an extracellular domain, a transmembrane domain, and a cytoplasmic domain.

The extracellular domain of CLEC6A contains a carbohydrate recognition domain (CRD) that is responsible for binding to specific sugar molecules, such as β-glucans found on the surface of pathogens. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic domain is involved in signal transduction, which will be discussed in the next section.

Activity of Recombinant Mouse CLEC6A Protein

The main function of CLEC6A is to recognize and bind to β-glucans, which are polysaccharides found in the cell wall of various fungi, bacteria, and plants. This binding triggers a signaling cascade that leads to the activation of immune cells, such as dendritic cells, macrophages, and neutrophils. This, in turn, promotes the production and release of pro-inflammatory cytokines and chemokines, which play a crucial role in the immune response against pathogens.

In addition to its role in pathogen recognition, CLEC6A has also been shown to play a role in the clearance of apoptotic cells and the maintenance of tissue homeostasis. It does so by recognizing and binding to apoptotic cells, which triggers phagocytosis and the release of anti-inflammatory cytokines, thus preventing excessive inflammation and tissue damage.

Applications of Recombinant Mouse CLEC6A Protein

The ability of CLEC6A to specifically bind to β-glucans and activate immune cells has made it a promising target for various applications in research and medicine. One of the main applications of recombinant CLEC6A protein is in the development of vaccines. By incorporating β-glucans into vaccines, along with other antigens, CLEC6A can enhance the immune response and improve the efficacy of the vaccine.

Another potential application of recombinant CLEC6A is in the treatment of fungal and bacterial infections. By targeting the β-glucans on the surface of these pathogens, CLEC6A can activate immune cells and promote their clearance. This has been demonstrated in studies using recombinant CLEC6A protein in animal models of fungal and bacterial infections, showing promising results.

Furthermore, the role of CLEC6A in the recognition and clearance of apoptotic cells has also led to its potential use in autoimmune diseases and cancer treatment. By targeting and activating CLEC6A, it may be possible to promote the clearance of apoptotic cells and prevent the development of autoimmune diseases. Additionally, CLEC6A has been found to be expressed on the surface of certain cancer cells, making it a potential target for immunotherapy.

Conclusion

In summary, recombinant mouse CLEC6A protein is a structurally and functionally important protein that plays a crucial role in immune response and disease treatment. Its ability to recognize

Recombinant Mouse CLEC6A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CLEC6A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products