Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse AMIGO1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q80ZD8
Molecular weight:
29.37 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Asn37–Asn269
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse AMIGO1 Protein, N-His

Product name ARO-P10509-100
Uniprot ID Q80ZD8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFN
Molecular weight 29.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Asn269
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P10509
Note For research use only.
Molecular Constructor
Asn37–Asn269
Product name ARO-P10509-1MG
Uniprot ID Q80ZD8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFN
Molecular weight 29.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Asn269
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P10509
Note For research use only.
Molecular Constructor
Asn37–Asn269
Product name ARO-P10509-50
Uniprot ID Q80ZD8
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NCLCASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFN
Molecular weight 29.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Asn269
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P10509
Note For research use only.
Molecular Constructor
Asn37–Asn269

Introduction to Recombinant Mouse AMIGO1 Protein

Recombinant Mouse AMIGO1 Protein is a highly versatile and valuable tool in the field of molecular biology. This protein is a member of the AMIGO (Altered Migration of Growth and Differentiation Factor-Induced Oligodendrocyte) family, which plays an important role in the development and maintenance of the nervous system. In this article, we will explore the structure, activity, and application of this recombinant protein.

Structure of Recombinant Mouse AMIGO1 Protein

Recombinant Mouse AMIGO1 Protein is a 93-kDa transmembrane protein that is encoded by the AMIGO1 gene located on chromosome 14 in mice. It is composed of 835 amino acids and contains a signal peptide, a single transmembrane domain, and a large extracellular domain. The extracellular domain has five immunoglobulin-like domains, which are important for protein-protein interactions. The cytoplasmic domain of AMIGO1 contains a PDZ-binding motif, which is involved in intracellular signaling.

Activity of Recombinant Mouse AMIGO1 Protein

The primary function of Recombinant Mouse AMIGO1 Protein is to regulate neuronal migration and axon guidance during development. It is expressed in various regions of the developing nervous system, including the cerebral cortex, hippocampus, and cerebellum. AMIGO1 interacts with various proteins, such as Netrin-1, to regulate neuronal migration and axon guidance. It also plays a role in synapse formation and plasticity, as well as in the maintenance of myelinated axons.

Studies have shown that AMIGO1 is upregulated in response to injury or inflammation in the nervous system. This suggests that it may also play a role in neuroprotection and repair. Additionally, AMIGO1 has been implicated in various neurological disorders, such as schizophrenia and epilepsy, highlighting its importance in maintaining proper neuronal function.

Application of Recombinant Mouse AMIGO1 Protein

The recombinant form of AMIGO1 is widely used in research laboratories for various applications. One of the main uses of this protein is in studying its role in neuronal development and function. Recombinant AMIGO1 can be used in in vitro assays to study its interaction with other proteins and its effects on neuronal migration, axon guidance, and synapse formation.

Furthermore, recombinant AMIGO1 can be used in animal models to investigate its role in neurological disorders. By overexpressing or suppressing AMIGO1 levels in these models, researchers can gain a better understanding of its function and potential therapeutic applications.

In addition, recombinant AMIGO1 can be used as an antigen in the development of diagnostic tools for neurological disorders. Antibodies against AMIGO1 can be used to detect its expression levels in patient samples, providing a potential biomarker for disease diagnosis.

Conclusion

Recombinant Mouse AMIGO1 Protein is a crucial player in the development and maintenance of the nervous system. Its structure, activity, and application have been extensively studied, and it continues to be a valuable tool in the field of molecular biology. As research on AMIGO1 continues, it has the potential to provide insights into various neurological disorders and potentially lead to the development of new therapies.

Recombinant Mouse AMIGO1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse AMIGO1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products