Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Monkeypox virus/MPXV C19L Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (MPXV)
Uniprot ID:
A0A7H0DN30
Molecular weight:
43.97 kDa

302.00

100ug + 302 loyalty points
His Met1–Ile372
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Monkeypox virus/MPXV C19L Protein, N-His

Product name Recombinant Monkeypox virus/MPXV C19L Protein, N-His
Uniprot ID A0A7H0DN30
Origin species Monkeypox virus (MPXV)
Expression system Prokaryotic expression
Raw Antigen Sequence MWPFASVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEVSEKGIKIIVLLDERGKRNLGELQSHSPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKI
Molecular weight 43.97 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ile372
Aliases /Synonyms Monkeypox C19L, clade 2
Reference PX-P6007
Note For research use only.
Molecular Constructor
His Met1–Ile372

SDS-PAGE For Recombinant Monkeypox virus/MPXV C19L Protein, N-His

SDS-PAGE For Recombinant Monkeypox virus/MPXV C19L Protein, N-His

Recombinant Monkeypox virus/MPXV C19L Protein, N-His, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

Recombinant Monkeypox virus/MPXV C19L Protein, N-His

  • Kinganda-Lusamaki, E.; Baketana, L.K.; Ndomba-Mukanya, E.; Bouillin, J.; Thaurignac, G.; Aziza, A.A.; Luakanda-Ndelemo, G.; Nuñez, N.F.; Kalonji-Mukendi, T.; Pukuta, E.S.; et al. Use of Mpox Multiplex Serology in the Identification of Cases and Outbreak Investigations in the Democratic Republic of the Congo (DRC). Pathogens 2023, 12, 916. https://doi.org/10.3390/pathogens12070916

There are no reviews yet.

Be the first to review “Recombinant Monkeypox virus/MPXV C19L Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products