Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ZBP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H171
Molecular weight:
20.20 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Arg10–Pro167
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ZBP1, N-His

Product name ARO-P13115-100
Uniprot ID Q9H171
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRP
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg10-Pro167
Aliases /Synonyms DNA-dependent activator of IFN-regulatory factors, DLM1, ZBP1, C20orf183, Z-DNA-binding protein 1, DAI, Tumor stroma and activated macrophage protein DLM-1
Reference ARO-P13115
Note For research use only.
Molecular Constructor
Arg10–Pro167
Product name ARO-P13115-1MG
Uniprot ID Q9H171
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRP
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg10-Pro167
Aliases /Synonyms DNA-dependent activator of IFN-regulatory factors, DLM1, ZBP1, C20orf183, Z-DNA-binding protein 1, DAI, Tumor stroma and activated macrophage protein DLM-1
Reference ARO-P13115
Note For research use only.
Molecular Constructor
Arg10–Pro167
Product name ARO-P13115-50
Uniprot ID Q9H171
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRP
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg10-Pro167
Aliases /Synonyms DNA-dependent activator of IFN-regulatory factors, DLM1, ZBP1, C20orf183, Z-DNA-binding protein 1, DAI, Tumor stroma and activated macrophage protein DLM-1
Reference ARO-P13115
Note For research use only.
Molecular Constructor
Arg10–Pro167

Introduction

Recombinant Human ZBP1, also known as Z-DNA binding protein 1, is a protein that plays a crucial role in the regulation of immune response and cell death. It is a member of the Z-DNA binding protein family and is encoded by the ZBP1 gene in humans.

Structure of Recombinant Human ZBP1

Recombinant Human ZBP1 is a 72 kDa protein that consists of 622 amino acids. It is composed of several domains, including a Z-DNA binding domain, a death domain, and a caspase recruitment domain. The Z-DNA binding domain is responsible for binding to Z-DNA, a left-handed conformation of DNA that is formed under certain conditions, such as during viral infection or cellular stress. The death domain and caspase recruitment domain are involved in signaling pathways that lead to cell death.

Activity of Recombinant Human ZBP1

Recombinant Human ZBP1 is a key regulator of immune response and cell death. It is primarily expressed in immune cells, such as macrophages and dendritic cells, and is induced upon viral infection or cellular stress. The protein is involved in the recognition of viral nucleic acids, specifically Z-DNA, which triggers the activation of the innate immune response. This leads to the production of pro-inflammatory cytokines and chemokines, as well as the recruitment of immune cells to the site of infection.

In addition to its role in immune response, Recombinant Human ZBP1 also plays a crucial role in cell death. It has been shown to induce apoptosis, a form of programmed cell death, in response to viral infection or cellular stress. This is mediated through the activation of the caspase pathway, which ultimately leads to the fragmentation of DNA and cell death.

Application of Recombinant Human ZBP1

The unique properties of Recombinant Human ZBP1 make it a valuable tool for various applications in the field of immunology and cell biology. One of its main applications is in the study of viral infection and host immune response. Recombinant Human ZBP1 can be used to investigate the mechanisms by which viral nucleic acids are recognized and how this leads to the activation of the immune response.

Furthermore, Recombinant Human ZBP1 has potential therapeutic applications in the treatment of viral infections and cancer. As it is involved in the induction of cell death, targeting this protein could potentially be used to eliminate infected or cancerous cells. Additionally, Recombinant Human ZBP1 can be used in the development of vaccines, as it can stimulate the production of pro-inflammatory cytokines and chemokines that are important for mounting an effective immune response.

Conclusion

Recombinant Human ZBP1 is a unique protein that plays a crucial role in the regulation of immune response and cell death. Its structure, activity, and applications make it a valuable tool for studying viral infection, host immune response, and potential therapeutic interventions. Further research on this protein could lead to a better understanding of its role in the immune system and its potential as a therapeutic target.

Recombinant Human ZBP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ZBP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products