Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human XRCC5/Ku80, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P13010

Original price was: €297.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
His Leu384–Ile732
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human XRCC5/Ku80, N-His

Product name ARO-P14031-100
Uniprot ID P13010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Protein delivered with Tag? N-Terminal His Tag
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu384-Ile732
Aliases /Synonyms Lupus Ku autoantigen protein p86, XRCC5, Thyroid-lupus autoantigen, Ku86, ATP-dependent DNA helicase 2 subunit 2, CTC85, G22P2, DNA repair protein XRCC5, 86 kDa subunit of Ku antigen, TLAA, Nuclear factor IV, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit, CTCBF, Ku80, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5
Reference ARO-P14031
Note For research use only.
Molecular Constructor
His Leu384–Ile732
Product name ARO-P14031-1MG
Uniprot ID P13010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Protein delivered with Tag? N-Terminal His Tag
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu384-Ile732
Aliases /Synonyms Lupus Ku autoantigen protein p86, XRCC5, Thyroid-lupus autoantigen, Ku86, ATP-dependent DNA helicase 2 subunit 2, CTC85, G22P2, DNA repair protein XRCC5, 86 kDa subunit of Ku antigen, TLAA, Nuclear factor IV, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit, CTCBF, Ku80, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5
Reference ARO-P14031
Note For research use only.
Molecular Constructor
His Leu384–Ile732
Product name ARO-P14031-50
Uniprot ID P13010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Protein delivered with Tag? N-Terminal His Tag
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu384-Ile732
Aliases /Synonyms Lupus Ku autoantigen protein p86, XRCC5, Thyroid-lupus autoantigen, Ku86, ATP-dependent DNA helicase 2 subunit 2, CTC85, G22P2, DNA repair protein XRCC5, 86 kDa subunit of Ku antigen, TLAA, Nuclear factor IV, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit, CTCBF, Ku80, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5
Reference ARO-P14031
Note For research use only.
Molecular Constructor
His Leu384–Ile732

Recombinant Human XRCC5/Ku80, N-His

There are no reviews yet.

Be the first to review “Recombinant Human XRCC5/Ku80, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products