Brand: ProteoGenix

Recombinant Human XCL1/Lymphotactin Protein, N-GST

ARO-P14969-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: P47992
Molecular weight:: 11.45 kDa

Original price was: €276.00.Current price is: €228.00.

50ug 17% OFF + 228 loyalty points

GST Val22–Gly114

Size Size

50ug Original price was: €276.00.Current price is: €228.00.
100ug Original price was: €423.00.Current price is: €325.00.
1MG Original price was: €1,226.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant Human XCL1/Lymphotactin Protein, N-GST

Product name	ARO-P14969-100
Uniprot ID	P47992
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Molecular weight	11.45 kDa
Protein delivered with Tag?	N-Terminal GST Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Val22-Gly114
Aliases /Synonyms	SCM-1-alpha, Lymphotactin, XC chemokine ligand 1, XCL1, SCYC1, Small-inducible cytokine C1, Lymphotaxin, C motif chemokine 1, ATAC, Cytokine SCM-1, LTN
Reference	ARO-P14969
Note	For research use only.
Molecular Constructor	GST Val22–Gly114

Product name	ARO-P14969-1MG
Uniprot ID	P47992
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Molecular weight	11.45 kDa
Protein delivered with Tag?	N-Terminal GST Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Val22-Gly114
Aliases /Synonyms	SCM-1-alpha, Lymphotactin, XC chemokine ligand 1, XCL1, SCYC1, Small-inducible cytokine C1, Lymphotaxin, C motif chemokine 1, ATAC, Cytokine SCM-1, LTN
Reference	ARO-P14969
Note	For research use only.
Molecular Constructor	GST Val22–Gly114

Product name	ARO-P14969-50
Uniprot ID	P47992
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Molecular weight	11.45 kDa
Protein delivered with Tag?	N-Terminal GST Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Val22-Gly114
Aliases /Synonyms	SCM-1-alpha, Lymphotactin, XC chemokine ligand 1, XCL1, SCYC1, Small-inducible cytokine C1, Lymphotaxin, C motif chemokine 1, ATAC, Cytokine SCM-1, LTN
Reference	ARO-P14969
Note	For research use only.
Molecular Constructor	GST Val22–Gly114