Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WDR45 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y484
Molecular weight:
20.40 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Cys23–Ala184
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WDR45 Protein, N-His

Product name ARO-P12129-100
Uniprot ID Q9Y484
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSA
Molecular weight 20.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys23-Ala184
Aliases /Synonyms WD repeat-containing protein 45, WD repeat domain phosphoinositide-interacting protein 4, WDR45, WDRX1, WDRXI4, WIPI-4, WIPI4
Reference ARO-P12129
Note For research use only.
Molecular Constructor
Cys23–Ala184
Product name ARO-P12129-1MG
Uniprot ID Q9Y484
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSA
Molecular weight 20.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys23-Ala184
Aliases /Synonyms WD repeat-containing protein 45, WD repeat domain phosphoinositide-interacting protein 4, WDR45, WDRX1, WDRXI4, WIPI-4, WIPI4
Reference ARO-P12129
Note For research use only.
Molecular Constructor
Cys23–Ala184
Product name ARO-P12129-50
Uniprot ID Q9Y484
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSA
Molecular weight 20.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys23-Ala184
Aliases /Synonyms WD repeat-containing protein 45, WD repeat domain phosphoinositide-interacting protein 4, WDR45, WDRX1, WDRXI4, WIPI-4, WIPI4
Reference ARO-P12129
Note For research use only.
Molecular Constructor
Cys23–Ala184

Introduction

Recombinant Human WDR45 Protein, also known as WIPI4, is a protein that is encoded by the WDR45 gene in humans. It belongs to the WD repeat domain 45 family and is involved in various cellular processes, including autophagy and endocytosis. This protein has been extensively studied and has shown potential for use in various applications due to its unique structure and activity.

Structure of Recombinant Human WDR45 Protein

Recombinant Human WDR45 Protein is a 45 kDa protein that consists of 406 amino acids. It contains seven WD repeat domains, which are highly conserved regions that play a crucial role in protein-protein interactions. These domains are responsible for the specific binding of WDR45 to other proteins and are essential for its function.

In addition to the WD repeat domains, WDR45 also contains a proline-rich region and a coiled-coil domain. These regions are involved in protein folding and stability, as well as in mediating interactions with other proteins. The unique combination of these domains gives WDR45 its distinctive structure, making it a valuable protein for various applications.

Activity of Recombinant Human WDR45 Protein

Recombinant Human WDR45 Protein is primarily known for its role in autophagy, a cellular process that involves the degradation and recycling of damaged or unnecessary cellular components. WDR45 interacts with other proteins involved in the formation of autophagosomes, which are the key structures in the autophagy pathway. It has been shown to play a crucial role in regulating autophagosome formation and maturation, making it an essential protein for maintaining cellular homeostasis.

Moreover, WDR45 has also been found to be involved in endocytosis, which is the process of internalizing substances from the extracellular environment into the cell. It interacts with proteins that are responsible for the formation of clathrin-coated vesicles, which are involved in endocytosis. This suggests that WDR45 may play a role in regulating the uptake of various substances into the cell.

Application of Recombinant Human WDR45 Protein

Due to its unique structure and activity, Recombinant Human WDR45 Protein has a wide range of potential applications. One of the most promising areas of application is in the field of neurodegenerative diseases, particularly in the study of autophagy-related disorders such as neuronal ceroid lipofuscinosis (NCL). Mutations in the WDR45 gene have been linked to NCL, and studies have shown that WDR45 plays a crucial role in the disease pathology. Therefore, the use of recombinant WDR45 protein could aid in the understanding and potential treatment of NCL and other neurodegenerative diseases.

Additionally, WDR45 has been shown to interact with proteins involved in the formation of clathrin-coated vesicles, which are involved in endocytosis. This suggests that recombinant WDR45 protein could potentially be used in the development of targeted drug delivery systems, particularly for substances that are internalized through endocytosis.

Furthermore, the specific binding of WDR45 to other proteins through its WD repeat domains makes it a useful tool for studying protein-protein interactions. Recombinant WDR45 protein could be used in research to identify and characterize novel protein interactions, leading to a better understanding of various cellular processes.

Conclusion

In summary, Recombinant Human WDR45 Protein is a unique protein with a distinctive structure and activity. It plays a crucial role in autophagy and endocytosis, making it a valuable protein for various

Recombinant Human WDR45 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human WDR45 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products