Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WDR24 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96S15
Molecular weight:
23.93 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Glu57–Thr158
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WDR24 Protein, N-His-SUMO

Product name ARO-P11622-100
Uniprot ID Q96S15
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVST
Molecular weight 23.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu57-Thr158
Aliases /Synonyms WDR24, C16orf21, GATOR complex protein WDR24, WD repeat-containing protein 24
Reference ARO-P11622
Note For research use only.
Molecular Constructor
Glu57–Thr158
Product name ARO-P11622-1MG
Uniprot ID Q96S15
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVST
Molecular weight 23.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu57-Thr158
Aliases /Synonyms WDR24, C16orf21, GATOR complex protein WDR24, WD repeat-containing protein 24
Reference ARO-P11622
Note For research use only.
Molecular Constructor
Glu57–Thr158
Product name ARO-P11622-50
Uniprot ID Q96S15
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVST
Molecular weight 23.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu57-Thr158
Aliases /Synonyms WDR24, C16orf21, GATOR complex protein WDR24, WD repeat-containing protein 24
Reference ARO-P11622
Note For research use only.
Molecular Constructor
Glu57–Thr158

Title: Introduction to Recombinant Human WDR24 Protein

Recombinant Human WDR24 Protein, also known as WD repeat-containing protein 24, is a recently discovered protein that plays an important role in various cellular processes. This protein is encoded by the WDR24 gene and is highly conserved among different species. In this article, we will explore the structure, activity, and applications of this protein.

Title: Structure of Recombinant Human WDR24 Protein

Recombinant Human WDR24 Protein is a 60 kDa protein that consists of 535 amino acids. It contains seven WD40 repeats, which are short structural motifs that are involved in protein-protein interactions. These repeats are arranged in a beta-propeller structure, which is a common structural motif found in many proteins involved in signal transduction and protein-protein interactions. The N-terminal region of WDR24 contains a conserved domain called the DUF3664 domain, which is unique to this protein.

Title: Activity of Recombinant Human WDR24 Protein

Recombinant Human WDR24 Protein has been shown to be involved in various cellular processes, including cell cycle regulation, chromatin remodeling, and DNA damage response. It interacts with other proteins such as BRCA1 and BRCA2, which are known to be involved in DNA repair. WDR24 has also been found to play a role in regulating the activity of the tumor suppressor protein p53, which is important for maintaining genomic stability and preventing cancer development.

Title: Role of Recombinant Human WDR24 Protein in Cell Cycle Regulation

One of the key functions of Recombinant Human WDR24 Protein is its role in cell cycle regulation. It has been shown to interact with the cell cycle regulator protein CDK2, which is involved in the G1/S transition of the cell cycle. WDR24 has been found to regulate the activity of CDK2 and promote cell cycle progression. This suggests that WDR24 may play a crucial role in cell proliferation and growth.

Title: Involvement of Recombinant Human WDR24 Protein in Chromatin Remodeling

Chromatin remodeling is a process that involves the modification of the structure of DNA in order to regulate gene expression. Recombinant Human WDR24 Protein has been found to interact with the chromatin remodeling complex SWI/SNF, which is responsible for regulating gene expression by altering the accessibility of DNA. This suggests that WDR24 may play a role in regulating gene expression and ultimately cellular function.

Title: Applications of Recombinant Human WDR24 Protein

Due to its involvement in various cellular processes, Recombinant Human WDR24 Protein has potential applications in different fields of research. Its role in cell cycle regulation and DNA damage response makes it a potential target for cancer therapy. Additionally, its interaction with chromatin remodeling complexes suggests that it may have a role in epigenetic regulation, making it a potential target for treating diseases caused by dysregulated gene expression.

Title: Production of Recombinant Human WDR24 Protein

Recombinant Human WDR24 Protein can be produced using recombinant DNA technology. The gene encoding WDR24 can be cloned into a suitable expression vector and then expressed in a host cell, such as E. coli or mammalian cells. The recombinant protein can then be purified using various techniques, such as affinity chromatography, to obtain a highly pure and active form of the protein.

In conclusion, Recombinant Human WDR24 Protein is a structurally and functionally important protein that plays a role in various cellular processes. Its involvement in cell cycle regulation, chromatin remodeling, and DNA damage response makes it a potential target for therapeutic interventions. Further research on this protein may provide valuable insights into its role in different cellular pathways and its potential applications in medicine.

Recombinant Human WDR24 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human WDR24 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products