Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Recombinant human VEGF Receptor 1 protein-FLT 1
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Recombinant human VEGF Receptor 1 protein-FLT 1 |
|---|---|
| Uniprot ID | P17948 |
| Uniprot link | http://www.uniprot.org/uniprot/P17948 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIGSHHHHHH |
| Molecular weight | 37.7kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60%-70% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | EC 2.7.10.1, FLT, FLT 1, Flt-1, FLT1, Fms like tyrosine kinase 1, Fms related tyrosine kinase 1, Fms related tyrosine kinase 1 (vascular endothelial Growth Factor proteins/vascular permeability factor receptor), Fms related tyrosine kinase 1 vascular endothelial Growth Factor proteins/vascular permeability factor receptor, Fms-like tyrosine kinase 1, FRT, Soluble VEGF receptor 1 14, Soluble VEGFR1 variant 2, Soluble VEGFR1 variant 21, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, Vascular endothelial Growth Factor proteins receptor 1, Vascular endothelial Growth Factor proteins vascular permeability factor receptor, Vascular permeability factor receptor, Vascular permeability factor receptor 1, VEGFR 1, VEGFR-1, VEGFR1 |
| Reference | PX-P4058 |
| Note | For research use only |
Related products
Biosimilar
Icrucumab Biosimilar – Anti-FLT1, VEGFR-1 mAb – Research Grade
PX-TA1257 200€
Biosimilar
Emirodatamab Biosimilar – Anti-FLT3;CD3E mAb – Research Grade
PX-TA1833 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.