Brand: ProteoGenix

Recombinant Human UQCRQ Protein, N-His-KSI

ARO-P10164-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: O14949
Molecular weight:: 20.34 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points

Gly2–Arg40

Size Size

50ug Original price was: €222.00.Current price is: €193.00.
100ug Original price was: €314.00.Current price is: €275.00.
1MG Original price was: €1,037.00.Current price is: €798.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant Human UQCRQ Protein, N-His-KSI

Product name	ARO-P10164-100
Uniprot ID	O14949
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLR
Molecular weight	20.34 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly2-Arg40
Aliases /Synonyms	Cytochrome b-c1 complex subunit 8, Complex III subunit 8, Complex III subunit VIII, Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, UQCRQ
Reference	ARO-P10164
Note	For research use only.
Molecular Constructor	Gly2–Arg40

Product name	ARO-P10164-1MG
Uniprot ID	O14949
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLR
Molecular weight	20.34 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly2-Arg40
Aliases /Synonyms	Cytochrome b-c1 complex subunit 8, Complex III subunit 8, Complex III subunit VIII, Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, UQCRQ
Reference	ARO-P10164
Note	For research use only.
Molecular Constructor	Gly2–Arg40

Product name	ARO-P10164-50
Uniprot ID	O14949
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLR
Molecular weight	20.34 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly2-Arg40
Aliases /Synonyms	Cytochrome b-c1 complex subunit 8, Complex III subunit 8, Complex III subunit VIII, Ubiquinol-cytochrome c reductase complex 9.5 kDa protein, Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, UQCRQ
Reference	ARO-P10164
Note	For research use only.
Molecular Constructor	Gly2–Arg40