Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TSPAN9 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75954
Molecular weight:
23.63 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Tyr107–His203
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TSPAN9 Protein, N-His-SUMO

Product name ARO-P11280-100
Uniprot ID O75954
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKH
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr107-His203
Aliases /Synonyms Tetraspanin-9, NET5, Tetraspan NET-5, Tspan-9, TSPAN9
Reference ARO-P11280
Note For research use only.
Molecular Constructor
Tyr107–His203
Product name ARO-P11280-1MG
Uniprot ID O75954
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKH
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr107-His203
Aliases /Synonyms Tetraspanin-9, NET5, Tetraspan NET-5, Tspan-9, TSPAN9
Reference ARO-P11280
Note For research use only.
Molecular Constructor
Tyr107–His203
Product name ARO-P11280-50
Uniprot ID O75954
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKH
Molecular weight 23.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr107-His203
Aliases /Synonyms Tetraspanin-9, NET5, Tetraspan NET-5, Tspan-9, TSPAN9
Reference ARO-P11280
Note For research use only.
Molecular Constructor
Tyr107–His203

Introduction to Recombinant Human TSPAN9 Protein

Recombinant Human TSPAN9 Protein is a highly versatile and important protein that has gained significant attention in the scientific community due to its unique structure, diverse activities and wide range of applications. This protein belongs to the tetraspanin family, which is a group of transmembrane proteins that play crucial roles in various cellular processes such as cell adhesion, migration, and signaling.

Structure of Recombinant Human TSPAN9 Protein

The recombinant form of TSPAN9 protein is a 236 amino acid long protein with a molecular weight of approximately 26 kDa. It is composed of four transmembrane domains, two extracellular loops, and two intracellular loops. The extracellular loops contain several cysteine residues, which form disulfide bonds with other tetraspanins and contribute to the protein’s stability and function.

The intracellular loops of TSPAN9 protein interact with various signaling molecules, including protein kinases, phosphatases, and G proteins, to regulate cellular processes. The transmembrane domains are responsible for the protein’s localization to specific membrane microdomains, known as tetraspanin-enriched microdomains (TEMs), which are essential for its functions.

Activity of Recombinant Human TSPAN9 Protein

Recombinant Human TSPAN9 Protein has been shown to have a wide range of activities in different cell types. It is involved in cell adhesion and migration by interacting with other tetraspanins, integrins, and adhesion molecules. It also plays a role in intracellular signaling by regulating the activity of various signaling molecules, including protein kinases and phosphatases.

One of the most unique activities of TSPAN9 protein is its ability to regulate the function of immune cells. It has been shown to modulate the activation, proliferation, and differentiation of T cells, B cells, and natural killer (NK) cells. This makes it a potential target for immunotherapy and cancer treatment.

Furthermore, TSPAN9 protein has been implicated in the regulation of tumor growth and metastasis. It has been shown to promote the proliferation and migration of cancer cells, making it a potential target for cancer therapy. On the other hand, some studies have also suggested that TSPAN9 protein may have tumor-suppressive effects, highlighting its complex role in cancer biology.

Application of Recombinant Human TSPAN9 Protein

The unique structure and diverse activities of Recombinant Human TSPAN9 Protein make it a valuable tool for various applications in the field of biotechnology and medicine. One of the most common applications of this protein is in the production of recombinant vaccines. TSPAN9 protein has been used as an antigen in vaccine formulations to induce immune responses against various diseases, including influenza, hepatitis C, and HIV.

Another potential application of TSPAN9 protein is in the development of targeted drug delivery systems. As this protein is highly expressed on the surface of cancer cells, it can be used as a target for delivering anti-cancer drugs specifically to tumor cells, minimizing the side effects on healthy tissues.

Moreover, recombinant TSPAN9 protein has also been used in diagnostic assays to detect the presence of specific antibodies in patient samples. Its ability to interact with various signaling molecules also makes it a potential therapeutic target for the treatment of autoimmune diseases and inflammatory disorders.

Conclusion

In conclusion, Recombinant Human TSPAN9 Protein is a highly versatile and important protein with a unique structure and diverse activities. It plays crucial roles in various cellular processes and has a wide range of potential applications in biotechnology and medicine. Further research on this protein is needed to fully understand its functions and potential therapeutic uses.

Recombinant Human TSPAN9 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TSPAN9 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products