Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TSPAN13 Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95857
Molecular weight:
10.78 kDa

Original price was: €314.00.Current price is: €275.00.

100ug 12% OFF + 275 loyalty points
Cys94–Glu164
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TSPAN13 Protein, C-His

Product name ARO-P10330-100
Uniprot ID O95857
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGE
Molecular weight 10.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys94-Glu164
Aliases /Synonyms Tetraspan NET-6, TM4SF13, NET6, Tetraspanin-13, Tspan-13, TSPAN13, Transmembrane 4 superfamily member 13
Reference ARO-P10330
Note For research use only.
Molecular Constructor
Cys94–Glu164
Product name ARO-P10330-1MG
Uniprot ID O95857
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGE
Molecular weight 10.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys94-Glu164
Aliases /Synonyms Tetraspan NET-6, TM4SF13, NET6, Tetraspanin-13, Tspan-13, TSPAN13, Transmembrane 4 superfamily member 13
Reference ARO-P10330
Note For research use only.
Molecular Constructor
Cys94–Glu164
Product name ARO-P10330-50
Uniprot ID O95857
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGE
Molecular weight 10.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys94-Glu164
Aliases /Synonyms Tetraspan NET-6, TM4SF13, NET6, Tetraspanin-13, Tspan-13, TSPAN13, Transmembrane 4 superfamily member 13
Reference ARO-P10330
Note For research use only.
Molecular Constructor
Cys94–Glu164

Introduction to Recombinant Human TSPAN13 Protein

Recombinant Human TSPAN13 Protein, also known as Tetraspanin-13, is a transmembrane protein that is encoded by the TSPAN13 gene. This protein is a member of the tetraspanin family, which is a group of proteins that are characterized by four transmembrane domains and play important roles in cell adhesion, migration, and signaling. Recombinant Human TSPAN13 Protein is produced through genetic engineering techniques, making it a highly purified and biologically active protein that can be used in various research and therapeutic applications.

Structure of Recombinant Human TSPAN13 Protein

The primary structure of Recombinant Human TSPAN13 Protein consists of 238 amino acids, with a predicted molecular weight of approximately 27 kDa. It contains four transmembrane domains, a large extracellular loop, and a small intracellular loop. The extracellular loop is rich in cysteine residues, which are important for protein folding and interactions with other proteins. The intracellular loop contains a conserved motif that is involved in protein-protein interactions and signal transduction.

Recombinant Human TSPAN13 Protein is expressed in mammalian cells and undergoes post-translational modifications, such as glycosylation and palmitoylation, which are important for its stability and function. The glycosylation of TSPAN13 has been shown to affect its interaction with other tetraspanins and its ability to regulate cell adhesion and migration.

Activity of Recombinant Human TSPAN13 Protein

Recombinant Human TSPAN13 Protein has been shown to have multiple activities in various cellular processes. It is involved in the formation and maintenance of cell-cell contacts, as well as cell-matrix interactions. It has also been implicated in cell migration, invasion, and proliferation. TSPAN13 has been found to interact with other tetraspanins, such as CD9 and CD81, and regulate their functions in cell adhesion and migration.

Furthermore, Recombinant Human TSPAN13 Protein has been shown to play a role in immune response and inflammation. It is expressed on the surface of immune cells, such as T cells, B cells, and dendritic cells, and has been found to modulate their functions. TSPAN13 has also been identified as a potential antigen in autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis.

Application of Recombinant Human TSPAN13 Protein

Recombinant Human TSPAN13 Protein has a wide range of applications in both research and therapeutic settings. In research, it can be used as a tool to study the function and regulation of tetraspanins, as well as the role of TSPAN13 in cellular processes. It can also be used to investigate the potential of TSPAN13 as a therapeutic target in various diseases.

In therapeutic applications, Recombinant Human TSPAN13 Protein can be used as a vaccine antigen to induce an immune response against specific diseases. It can also be used in antibody-based therapies to target TSPAN13-expressing cells, such as cancer cells or immune cells in autoimmune diseases. Furthermore, TSPAN13 has been identified as a potential biomarker for certain diseases, making Recombinant Human TSPAN13 Protein a valuable tool for diagnostic purposes.

Conclusion

Recombinant Human TSPAN13 Protein is a biologically active and highly purified protein that has multiple activities and applications. Its structure, function, and potential as a therapeutic target make it an important protein in the field of cell biology and immunology. With ongoing research, Recombinant Human TSPAN13 Protein has the potential to contribute to the development of new treatments for various diseases and further our understanding of cellular processes.

Recombinant Human TSPAN13 Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human TSPAN13 Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products