Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TMPRSS4, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRS4
Molecular weight:
44.68 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Lys54–Leu437
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TMPRSS4, N-His

Product name ARO-P13062-100
Uniprot ID Q9NRS4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Molecular weight 44.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys54-Leu437
Aliases /Synonyms CAPH2, Transmembrane protease serine 4, TMPRSS3, TMPRSS4, Channel-activating protease 2, Membrane-type serine protease 2, MT-SP2
Reference ARO-P13062
Note For research use only.
Molecular Constructor
Lys54–Leu437
Product name ARO-P13062-1MG
Uniprot ID Q9NRS4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Molecular weight 44.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys54-Leu437
Aliases /Synonyms CAPH2, Transmembrane protease serine 4, TMPRSS3, TMPRSS4, Channel-activating protease 2, Membrane-type serine protease 2, MT-SP2
Reference ARO-P13062
Note For research use only.
Molecular Constructor
Lys54–Leu437
Product name ARO-P13062-50
Uniprot ID Q9NRS4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Molecular weight 44.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys54-Leu437
Aliases /Synonyms CAPH2, Transmembrane protease serine 4, TMPRSS3, TMPRSS4, Channel-activating protease 2, Membrane-type serine protease 2, MT-SP2
Reference ARO-P13062
Note For research use only.
Molecular Constructor
Lys54–Leu437

Recombinant Human TMPRSS4: Structure, Activity, and Applications

Introduction

Recombinant proteins have become essential tools in the field of biotechnology, offering a wide range of applications in research, diagnostics, and therapeutics. One such protein is the human Transmembrane Protease Serine 4 (TMPRSS4), which has gained significant attention due to its role in cancer progression and metastasis. In this article, we will discuss the structure, activity, and applications of recombinant human TMPRSS4.

Structure of Recombinant Human TMPRSS4

TMPRSS4 is a type II transmembrane serine protease, consisting of 492 amino acids. It belongs to the family of serine proteases, which are enzymes that cleave other proteins at specific sites. The protein is composed of four domains: a cytoplasmic domain, a transmembrane domain, a stem region, and a catalytic domain. The catalytic domain is responsible for the proteolytic activity of TMPRSS4, while the stem region and transmembrane domain anchor the protein to the cell membrane.

Recombinant Protein Production

Recombinant human TMPRSS4 is produced through genetic engineering techniques, where the gene for TMPRSS4 is inserted into a suitable expression vector and transferred into host cells, such as bacteria, yeast, or mammalian cells. The protein is then produced in large quantities using fermentation or cell culture methods.

Activity of Recombinant Human TMPRSS4

TMPRSS4 plays a crucial role in cancer progression and metastasis by promoting the activation of other proteins involved in these processes. It has been shown to activate the hepatocyte growth factor (HGF) and its receptor c-Met, which are essential for cancer cell migration and invasion. TMPRSS4 also activates the epidermal growth factor receptor (EGFR), which is involved in cell proliferation and survival. Additionally, TMPRSS4 has been found to cleave and activate the protease-activated receptor 2 (PAR2), which is associated with inflammation and tumor growth.

Applications of Recombinant Human TMPRSS4

Recombinant human TMPRSS4 has a wide range of applications in both research and clinical settings. Here are some of the key applications of this protein:

Antigen for Antibody Production

Recombinant human TMPRSS4 can be used as an antigen to generate antibodies for research purposes. These antibodies can be used to study the expression and localization of TMPRSS4 in different tissues and cell types, as well as its role in cancer progression and metastasis.

Diagnostics

TMPRSS4 has been identified as a potential biomarker for various types of cancer, including lung, breast, and pancreatic cancer. Recombinant human TMPRSS4 can be used to develop diagnostic tests for the early detection and monitoring of these cancers.

Therapeutics

Given its role in cancer progression and metastasis, TMPRSS4 has emerged as a potential target for cancer therapy. Recombinant human TMPRSS4 can be used to screen for small molecule inhibitors that can block its activity and potentially inhibit cancer growth and metastasis.

Potential for Other Applications

Apart from its role in cancer, TMPRSS4 has also been implicated in other diseases, such as respiratory infections and inflammatory bowel disease. Recombinant human TMPRSS4 can be used to further study the role of this protein in these conditions and potentially develop new treatments.

Conclusion

Recombinant human TMPRSS4 is a crucial protein with diverse functions and applications. Its structure, activity, and potential for various applications make it a promising target for further research and development. With ongoing advancements in biotechnology, we can expect to see more applications of this protein in the future, leading

Recombinant Human TMPRSS4, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TMPRSS4, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products