Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TIMM9 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y5J7
Molecular weight:
22.59 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Ala2–Arg89
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TIMM9 Protein, N-His-SUMO

Product name ARO-P11685-100
Uniprot ID Q9Y5J7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Molecular weight 22.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Arg89
Aliases /Synonyms TIMM9, Mitochondrial import inner membrane translocase subunit Tim9, TIM9, TIMM9A, TIM9A
Reference ARO-P11685
Note For research use only.
Molecular Constructor
Ala2–Arg89
Product name ARO-P11685-1MG
Uniprot ID Q9Y5J7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Molecular weight 22.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Arg89
Aliases /Synonyms TIMM9, Mitochondrial import inner membrane translocase subunit Tim9, TIM9, TIMM9A, TIM9A
Reference ARO-P11685
Note For research use only.
Molecular Constructor
Ala2–Arg89
Product name ARO-P11685-50
Uniprot ID Q9Y5J7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Molecular weight 22.59 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Arg89
Aliases /Synonyms TIMM9, Mitochondrial import inner membrane translocase subunit Tim9, TIM9, TIMM9A, TIM9A
Reference ARO-P11685
Note For research use only.
Molecular Constructor
Ala2–Arg89

Introduction

Recombinant Human TIMM9 Protein, also known as Translocase of Inner Mitochondrial Membrane 9, is a protein that plays a crucial role in mitochondrial protein import and assembly. It is a member of the TIMM family of proteins, which are involved in the translocation of proteins from the cytosol into the mitochondria. In this article, we will explore the structure, activity, and applications of Recombinant Human TIMM9 Protein.

Structure of Recombinant Human TIMM9 Protein

Recombinant Human TIMM9 Protein is a 10 kDa protein consisting of 91 amino acids. It is composed of a transmembrane domain and a cytoplasmic domain. The transmembrane domain contains two alpha-helices, while the cytoplasmic domain contains a conserved cysteine-rich region. This structure is essential for the function of TIMM9 in protein import and assembly.

Activity of Recombinant Human TIMM9 Protein

The main function of Recombinant Human TIMM9 Protein is to facilitate the import of nuclear-encoded proteins into the mitochondria. It does this by forming a complex with other TIMM family proteins, such as TIMM10 and TIMM12, to create a translocation channel in the mitochondrial inner membrane. This channel allows for the passage of newly synthesized proteins from the cytosol into the mitochondria.

In addition to its role in protein import, Recombinant Human TIMM9 Protein is also involved in the assembly of respiratory chain complexes. It is required for the proper folding and assembly of the cytochrome c oxidase subunit Cox2, which is essential for the function of the respiratory chain. This highlights the importance of TIMM9 in maintaining mitochondrial function and cellular energy production.

Applications of Recombinant Human TIMM9 Protein

Recombinant Human TIMM9 Protein has a wide range of applications in both research and clinical settings. One of its primary uses is in the study of mitochondrial disorders. Mutations in TIMM9 have been linked to several mitochondrial diseases, including deafness, encephalopathy, and Leigh syndrome. Recombinant Human TIMM9 Protein can be used to investigate the role of these mutations in disease development and progression.

Additionally, Recombinant Human TIMM9 Protein has potential therapeutic applications. It has been shown to have a protective effect against oxidative stress-induced cell death in neuronal cells, making it a potential target for neuroprotective therapies. It has also been studied as a potential treatment for cancer, as it has been found to inhibit the growth of tumor cells.

In the field of biotechnology, Recombinant Human TIMM9 Protein is used in the production of recombinant proteins. It is commonly used as a fusion partner for the expression and purification of target proteins, as its small size and stability make it an ideal carrier protein.

Conclusion

In summary, Recombinant Human TIMM9 Protein is a crucial component of the mitochondrial protein import and assembly machinery. Its structure, activity, and applications make it a valuable tool in understanding mitochondrial disorders, developing potential therapies, and producing recombinant proteins. Further research on this protein and its role in cellular function and disease will continue to expand our understanding of its importance in maintaining mitochondrial homeostasis.

Recombinant Human TIMM9 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TIMM9 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products