Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SRPX2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60687
Molecular weight:
47.80 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Asp66–Glu465
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SRPX2 Protein, N-His

Product name ARO-P11830-100
Uniprot ID O60687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Molecular weight 47.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp66-Glu465
Aliases /Synonyms Sushi-repeat protein upregulated in leukemia, SRPUL, Sushi repeat-containing protein SRPX2, SRPX2
Reference ARO-P11830
Note For research use only.
Molecular Constructor
Asp66–Glu465
Product name ARO-P11830-1MG
Uniprot ID O60687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Molecular weight 47.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp66-Glu465
Aliases /Synonyms Sushi-repeat protein upregulated in leukemia, SRPUL, Sushi repeat-containing protein SRPX2, SRPX2
Reference ARO-P11830
Note For research use only.
Molecular Constructor
Asp66–Glu465
Product name ARO-P11830-50
Uniprot ID O60687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Molecular weight 47.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp66-Glu465
Aliases /Synonyms Sushi-repeat protein upregulated in leukemia, SRPUL, Sushi repeat-containing protein SRPX2, SRPX2
Reference ARO-P11830
Note For research use only.
Molecular Constructor
Asp66–Glu465

Introduction

Recombinant proteins are proteins that are produced in a laboratory using recombinant DNA technology. These proteins are widely used in various fields of research, diagnostics, and therapeutics due to their high purity, specificity, and reproducibility. One such protein is Recombinant Human SRPX2 Protein, which has gained significant attention in recent years due to its unique structure, activity, and potential applications.

Structure of Recombinant Human SRPX2 Protein

Recombinant Human SRPX2 Protein is a glycoprotein consisting of 583 amino acids with a molecular weight of approximately 66 kDa. It is encoded by the SRPX2 gene located on chromosome X and is highly conserved among different species. The protein contains a signal peptide, an N-terminal sushi domain, and a C-terminal SRPX domain. The sushi domain is responsible for protein-protein interactions, while the SRPX domain is believed to play a role in protein folding and stability.

The protein also undergoes post-translational modifications, such as glycosylation, which adds sugar molecules to the protein and affects its function and stability. Recombinant Human SRPX2 Protein is produced in a mammalian expression system to ensure proper folding and glycosylation, resulting in a highly functional and stable protein.

Activity of Recombinant Human SRPX2 Protein

Recombinant Human SRPX2 Protein is a secreted protein that plays a crucial role in brain development and function. It is primarily expressed in the central nervous system, particularly in the cerebral cortex and hippocampus. Studies have shown that SRPX2 is involved in neuronal migration, synapse formation, and plasticity, and its dysregulation has been linked to various neurological disorders, including epilepsy and autism spectrum disorder.

The sushi domain of SRPX2 is responsible for its binding to the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor, a key player in excitatory neurotransmission. This interaction enhances the activity of the AMPA receptor, leading to increased synaptic transmission and plasticity. Additionally, SRPX2 has been shown to regulate the expression of genes involved in neuronal development and function, further highlighting its role in brain activity.

Application of Recombinant Human SRPX2 Protein

Due to its involvement in brain function and development, Recombinant Human SRPX2 Protein has potential applications in various fields, including neuroscience research, diagnostics, and therapeutics.

In research, SRPX2 is used as a tool to study the role of the protein in neuronal development and function. Recombinant Human SRPX2 Protein can be used to investigate the effects of SRPX2 dysregulation on neuronal activity and to identify potential therapeutic targets for neurological disorders.

In diagnostics, SRPX2 has been proposed as a potential biomarker for certain neurological disorders. Studies have shown that SRPX2 levels are altered in patients with epilepsy and autism spectrum disorder, making it a potential diagnostic tool for these conditions.

Lastly, Recombinant Human SRPX2 Protein has potential therapeutic applications in the treatment of neurological disorders. As SRPX2 dysregulation has been linked to these conditions, targeting the protein could potentially lead to the development of novel therapies. Additionally, SRPX2 has been shown to enhance synaptic activity, making it a potential target for drugs aimed at improving cognitive function.

Conclusion

In conclusion, Recombinant Human SRPX2 Protein is a unique and promising protein with a specific structure and activity. Its involvement in brain development and function makes it a valuable tool in research, diagnostics, and therapeutics. Further studies on this protein may lead to a better understanding of its role in neurological disorders and the development of new treatments.

Recombinant Human SRPX2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SRPX2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products