Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SMYD2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRG4
Molecular weight:
51.83 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Met1–His433
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SMYD2 Protein, N-His

Product name ARO-P11742-100
Uniprot ID Q9NRG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Molecular weight 51.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His433
Aliases /Synonyms HSKM-B, N-lysine methyltransferase SMYD2, Histone methyltransferase SMYD2, SMYD2, SET and MYND domain-containing protein 2, Lysine N-methyltransferase 3C, KMT3C
Reference ARO-P11742
Note For research use only.
Molecular Constructor
Met1–His433
Product name ARO-P11742-1MG
Uniprot ID Q9NRG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Molecular weight 51.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His433
Aliases /Synonyms HSKM-B, N-lysine methyltransferase SMYD2, Histone methyltransferase SMYD2, SMYD2, SET and MYND domain-containing protein 2, Lysine N-methyltransferase 3C, KMT3C
Reference ARO-P11742
Note For research use only.
Molecular Constructor
Met1–His433
Product name ARO-P11742-50
Uniprot ID Q9NRG4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Molecular weight 51.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-His433
Aliases /Synonyms HSKM-B, N-lysine methyltransferase SMYD2, Histone methyltransferase SMYD2, SMYD2, SET and MYND domain-containing protein 2, Lysine N-methyltransferase 3C, KMT3C
Reference ARO-P11742
Note For research use only.
Molecular Constructor
Met1–His433

Introduction to Recombinant Human SMYD2 Protein

Recombinant Human SMYD2 Protein is a highly purified and bioactive form of the human SMYD2 protein that is produced using recombinant DNA technology. This protein plays a crucial role in various cellular processes such as gene expression, DNA repair, and cell proliferation. In this article, we will delve into the structure, activity, and applications of this protein.

Structure of Recombinant Human SMYD2 Protein

The SMYD2 protein is a member of the SET and MYND domain-containing (SMYD) family of proteins. It is composed of 433 amino acids and has a molecular weight of 49 kDa. The protein contains a SET domain, which is responsible for its histone methyltransferase activity, and a MYND domain, which is involved in protein-protein interactions. The SET domain of SMYD2 is highly conserved and plays a crucial role in its enzymatic activity.

Activity of Recombinant Human SMYD2 Protein

Recombinant Human SMYD2 Protein is a histone methyltransferase, meaning it has the ability to add a methyl group to specific histone proteins. This modification of histones, known as methylation, plays a crucial role in regulating gene expression. SMYD2 specifically targets histone H3 at lysine 4 (H3K4), a modification associated with active gene transcription. By adding a methyl group to H3K4, SMYD2 promotes the recruitment of other transcriptional activators, leading to increased gene expression.

Apart from its histone methyltransferase activity, SMYD2 also has non-histone substrates, including p53, a tumor suppressor protein. SMYD2-mediated methylation of p53 has been shown to regulate its stability and function, thus playing a role in cell proliferation and apoptosis. Additionally, SMYD2 has been reported to methylate other non-histone proteins, such as heat shock protein 90 (HSP90) and retinoblastoma protein (Rb), which are involved in various cellular processes.

Applications of Recombinant Human SMYD2 Protein

The unique activity of Recombinant Human SMYD2 Protein makes it a valuable tool in various research areas. Its ability to specifically target histone H3K4 makes it a useful tool for studying gene expression and epigenetics. The protein can be used to investigate the role of SMYD2 in various cellular processes, such as cell proliferation, DNA repair, and apoptosis.

Moreover, SMYD2 has emerged as a potential therapeutic target in cancer. Its overexpression has been reported in various cancers, including breast, lung, and colon cancer. Inhibiting SMYD2 activity has been shown to decrease cell proliferation and induce apoptosis in cancer cells. Therefore, Recombinant Human SMYD2 Protein can be used to study the mechanism of action of SMYD2 inhibitors and their potential as anti-cancer agents.

In addition to its research applications, Recombinant Human SMYD2 Protein is also used in diagnostic assays. SMYD2 has been identified as a potential biomarker for various diseases, including cancer and cardiovascular diseases. Its levels in blood or tissue samples can be measured using Recombinant Human SMYD2 Protein as a standard, aiding in disease diagnosis and prognosis.

Conclusion

In summary, Recombinant Human SMYD2 Protein is a highly purified and bioactive form of the human SMYD2 protein. Its structure, activity, and applications make it a valuable tool in various research areas, including epigenetics, cancer, and diagnostics. Further studies on this protein and its role in cellular processes could lead to a better understanding of its function and potential therapeutic applications.

Recombinant Human SMYD2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SMYD2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products