Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLCO2A1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92959
Molecular weight:
22.72 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Met418–Ala518
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLCO2A1 Protein, N-His-SUMO

Product name ARO-P11942-100
Uniprot ID Q92959
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGCSTPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPA
Molecular weight 22.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met418-Ala518
Aliases /Synonyms OATP2A1, Solute carrier family 21 member 2, Prostaglandin transporter, Solute carrier organic anion transporter family member 2A1, SLCO2A1, SLC21A2, PGT
Reference ARO-P11942
Note For research use only.
Molecular Constructor
Met418–Ala518
Product name ARO-P11942-1MG
Uniprot ID Q92959
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGCSTPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPA
Molecular weight 22.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met418-Ala518
Aliases /Synonyms OATP2A1, Solute carrier family 21 member 2, Prostaglandin transporter, Solute carrier organic anion transporter family member 2A1, SLCO2A1, SLC21A2, PGT
Reference ARO-P11942
Note For research use only.
Molecular Constructor
Met418–Ala518
Product name ARO-P11942-50
Uniprot ID Q92959
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGCSTPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPA
Molecular weight 22.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met418-Ala518
Aliases /Synonyms OATP2A1, Solute carrier family 21 member 2, Prostaglandin transporter, Solute carrier organic anion transporter family member 2A1, SLCO2A1, SLC21A2, PGT
Reference ARO-P11942
Note For research use only.
Molecular Constructor
Met418–Ala518

Introduction

Recombinant Human SLCO2A1 Protein, also known as solute carrier organic anion transporter family, member 2A1, is a protein that plays a crucial role in the transport of prostaglandins and other organic anions across the cell membrane. This protein is encoded by the SLCO2A1 gene and is primarily expressed in the kidney, brain, and placenta. Recombinant Human SLCO2A1 Protein has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human SLCO2A1 Protein

Recombinant Human SLCO2A1 Protein is a transmembrane protein consisting of 12 transmembrane helices and two cytoplasmic domains. The protein has a molecular weight of approximately 70 kDa and is highly glycosylated. The primary structure of this protein is highly conserved among different species, indicating its importance in cellular function.

Activity of Recombinant Human SLCO2A1 Protein

Recombinant Human SLCO2A1 Protein functions as a transporter, specifically as an organic anion transporter. It is responsible for the uptake of prostaglandins, bile acids, and other organic anions from the extracellular environment into the cell. This process is essential for maintaining cellular homeostasis and regulating various physiological processes, such as inflammation, blood pressure, and lipid metabolism.

Studies have also shown that Recombinant Human SLCO2A1 Protein has a high affinity for certain drugs, such as non-steroidal anti-inflammatory drugs (NSAIDs) and anti-cancer agents. This suggests its potential role in drug absorption and distribution in the body.

Applications of Recombinant Human SLCO2A1 Protein

Recombinant Human SLCO2A1 Protein has a wide range of potential applications in various fields, including medicine, drug development, and biotechnology.

In medicine, this protein has been linked to several diseases and disorders, such as hypertension, inflammatory bowel disease, and cancer. Its role in the transport of prostaglandins makes it a potential target for the treatment of these conditions. Additionally, Recombinant Human SLCO2A1 Protein can also be used as a biomarker for the diagnosis and prognosis of certain diseases.

In drug development, this protein has been identified as a potential target for drug delivery systems. Its high expression in the kidney and brain makes it an attractive target for targeted drug delivery to these organs. Furthermore, the ability of Recombinant Human SLCO2A1 Protein to transport certain drugs suggests its potential use in drug screening and development.

In biotechnology, Recombinant Human SLCO2A1 Protein can be used for the production of recombinant proteins and antibodies. Its high expression in the placenta makes it a useful tool for studying placental transport and developing targeted therapies for pregnancy-related disorders.

Conclusion

In summary, Recombinant Human SLCO2A1 Protein is a transmembrane protein that plays a crucial role in the transport of prostaglandins and other organic anions. Its structure, activity, and potential applications have been extensively studied, and it has been identified as a potential target for drug development and a useful tool in biotechnology. Further research on this protein may lead to new insights into its function and potential therapeutic applications.

Recombinant Human SLCO2A1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SLCO2A1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products