Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SAMM50 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y512
Molecular weight:
40.53 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Leu125–Leu469
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SAMM50 Protein, N-His

Product name ARO-P11910-100
Uniprot ID Q9Y512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL
Molecular weight 40.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu125-Leu469
Aliases /Synonyms SAM50, Transformation-related gene 3 protein, Sorting and assembly machinery component 50 homolog, SAMM50, TRG-3
Reference ARO-P11910
Note For research use only.
Molecular Constructor
Leu125–Leu469
Product name ARO-P11910-1MG
Uniprot ID Q9Y512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL
Molecular weight 40.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu125-Leu469
Aliases /Synonyms SAM50, Transformation-related gene 3 protein, Sorting and assembly machinery component 50 homolog, SAMM50, TRG-3
Reference ARO-P11910
Note For research use only.
Molecular Constructor
Leu125–Leu469
Product name ARO-P11910-50
Uniprot ID Q9Y512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL
Molecular weight 40.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu125-Leu469
Aliases /Synonyms SAM50, Transformation-related gene 3 protein, Sorting and assembly machinery component 50 homolog, SAMM50, TRG-3
Reference ARO-P11910
Note For research use only.
Molecular Constructor
Leu125–Leu469

Introduction

Recombinant Human SAMM50 Protein is a highly purified and bioactive protein that is produced through recombinant DNA technology. This protein plays a crucial role in the structure and function of mitochondria, the powerhouse of the cell. In this article, we will discuss the structure, activity and potential applications of Recombinant Human SAMM50 Protein.

Structure of Recombinant Human SAMM50 Protein

Recombinant Human SAMM50 Protein is a 50-kDa protein that is composed of 434 amino acids. It is a transmembrane protein that is located in the outer membrane of mitochondria. The protein has a highly conserved SAM (sterile alpha motif) domain, which is important for protein-protein interactions. SAMM50 also contains a C-terminal domain that is essential for its localization to the mitochondrial outer membrane.

Activity of Recombinant Human SAMM50 Protein

SAMM50 is a crucial component of the mitochondrial protein import machinery. It plays a critical role in the assembly and stability of the mitochondrial protein translocase complex, which is responsible for transporting proteins from the cytosol into the mitochondria. SAMM50 forms a complex with other proteins, such as TOM40 and TOM22, to facilitate the import of precursor proteins into the mitochondria.

In addition to its role in protein import, SAMM50 also plays a role in mitochondrial dynamics. It interacts with proteins involved in mitochondrial fusion and fission, such as MFN1 and DRP1, to regulate the shape and size of mitochondria. SAMM50 also plays a role in maintaining the integrity of the mitochondrial outer membrane, which is important for the proper functioning of the organelle.

Applications of Recombinant Human SAMM50 Protein

Recombinant Human SAMM50 Protein has a wide range of potential applications in both research and clinical settings. Its role in mitochondrial protein import makes it a valuable tool for studying mitochondrial dysfunction and related diseases. Mutations in SAMM50 have been linked to neurodegenerative disorders, such as Parkinson’s disease and Alzheimer’s disease, making it a potential target for therapeutic interventions.

Furthermore, SAMM50 has been shown to be involved in the development and progression of cancer. Its overexpression has been observed in various types of cancer, including breast, colon, lung, and ovarian cancer. This makes it a potential biomarker for cancer diagnosis and a target for anti-cancer therapies.

In addition, recombinant SAMM50 protein can be used in in vitro studies to investigate its role in mitochondrial dynamics and function. It can also be used to screen for potential drugs that can modulate its activity, which can lead to the development of new treatments for mitochondrial disorders and cancer.

Conclusion

In summary, Recombinant Human SAMM50 Protein is a key player in the structure and function of mitochondria. Its role in protein import and mitochondrial dynamics makes it a crucial component of the organelle. Its potential applications in research and medicine make it a valuable tool for studying and treating various diseases. With further research, SAMM50 could potentially lead to new therapeutic strategies for mitochondrial disorders and cancer.

Recombinant Human SAMM50 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SAMM50 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products