Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RUVBL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y230
Molecular weight:
48.31 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Gln49–Ser463
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RUVBL2 Protein, N-His

Product name ARO-P12439-100
Uniprot ID Q9Y230
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDT
Molecular weight 48.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln49-Ser463
Aliases /Synonyms 48 kDa TATA box-binding protein-interacting protein, RuvB-like 2, INO80 complex subunit J, RUVBL2, TAP54-beta, Reptin 52, TIP60-associated protein 54-beta, TIP48, TIP49B, 51 kDa erythrocyte cytosolic protein, 48 kDa TBP-interacting protein, Repressing pontin 52, INO80J, TIP49b, ECP-51
Reference ARO-P12439
Note For research use only.
Molecular Constructor
Gln49–Ser463
Product name ARO-P12439-1MG
Uniprot ID Q9Y230
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDT
Molecular weight 48.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln49-Ser463
Aliases /Synonyms 48 kDa TATA box-binding protein-interacting protein, RuvB-like 2, INO80 complex subunit J, RUVBL2, TAP54-beta, Reptin 52, TIP60-associated protein 54-beta, TIP48, TIP49B, 51 kDa erythrocyte cytosolic protein, 48 kDa TBP-interacting protein, Repressing pontin 52, INO80J, TIP49b, ECP-51
Reference ARO-P12439
Note For research use only.
Molecular Constructor
Gln49–Ser463
Product name ARO-P12439-50
Uniprot ID Q9Y230
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDT
Molecular weight 48.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln49-Ser463
Aliases /Synonyms 48 kDa TATA box-binding protein-interacting protein, RuvB-like 2, INO80 complex subunit J, RUVBL2, TAP54-beta, Reptin 52, TIP60-associated protein 54-beta, TIP48, TIP49B, 51 kDa erythrocyte cytosolic protein, 48 kDa TBP-interacting protein, Repressing pontin 52, INO80J, TIP49b, ECP-51
Reference ARO-P12439
Note For research use only.
Molecular Constructor
Gln49–Ser463

The Structure of Recombinant Human RUVBL2 Protein

Recombinant Human RUVBL2 Protein, also known as RuvB-like 2 protein, is a highly conserved member of the AAA+ (ATPases associated with diverse cellular activities) family of proteins. It is encoded by the RUVBL2 gene and is found in all eukaryotic organisms. The protein is composed of 465 amino acids and has a molecular weight of approximately 52 kDa.

The primary structure of Recombinant Human RUVBL2 Protein consists of three main domains: an N-terminal domain, a central AAA+ domain, and a C-terminal domain. The N-terminal domain is responsible for protein-protein interactions and contains a conserved arginine finger motif, which is important for ATP hydrolysis. The central AAA+ domain is the main catalytic domain and contains the characteristic Walker A and B motifs, which are essential for ATP binding and hydrolysis. The C-terminal domain is involved in protein-protein interactions and has been shown to play a role in the assembly of large protein complexes.

The Activity of Recombinant Human RUVBL2 Protein

Recombinant Human RUVBL2 Protein is a multifunctional protein with diverse activities in various cellular processes. It is primarily known for its role as a molecular chaperone, which assists in the proper folding of other proteins. It also acts as an ATPase, utilizing the energy from ATP hydrolysis to drive its various functions.

One of the key activities of Recombinant Human RUVBL2 Protein is its involvement in the assembly and remodeling of large protein complexes. It has been shown to interact with a variety of proteins, including transcription factors, chromatin remodelers, and DNA repair proteins, and facilitate their assembly into functional complexes. This activity is crucial for various cellular processes, such as DNA replication, transcription, and DNA repair.

Recombinant Human RUVBL2 Protein also plays a role in regulating gene expression. It has been shown to interact with transcription factors and co-activators, and modulate their activity. This function is important for maintaining proper gene expression and ensuring normal cellular function.

In addition, Recombinant Human RUVBL2 Protein has been implicated in cell cycle regulation. It interacts with key regulators of the cell cycle, such as cyclins and cyclin-dependent kinases, and is involved in the proper progression of the cell cycle. It has also been shown to play a role in cell proliferation and apoptosis.

The Application of Recombinant Human RUVBL2 Protein

Recombinant Human RUVBL2 Protein has a wide range of applications in both basic research and biotechnology. Its role as a molecular chaperone and its involvement in the assembly of large protein complexes make it a valuable tool for studying protein-protein interactions and protein complex assembly. It has been used in various in vitro assays to study the function of specific proteins and their interactions.

In the field of biotechnology, Recombinant Human RUVBL2 Protein has been used in the production of recombinant proteins. Its chaperone activity can aid in the proper folding and assembly of recombinant proteins, ensuring their functionality. It has also been used in the development of gene therapy and drug delivery systems, as it can interact with viral proteins and assist in their assembly.

Furthermore, Recombinant Human RUVBL2 Protein has been linked to various diseases and disorders, including cancer, neurodegenerative diseases, and developmental disorders. Its involvement in key cellular processes makes it a potential target for therapeutic interventions and a biomarker for disease diagnosis.

In conclusion, Recombinant Human RUVBL2 Protein is a highly versatile and important protein with a diverse range of activities and applications. Its structure and function make it a valuable tool for studying various cellular processes and its potential therapeutic applications make it a promising target for future research.

Recombinant Human RUVBL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RUVBL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products