Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RNF6 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y252
Molecular weight:
24.42 kDa

Original price was: €311.00.Current price is: €275.00.

100ug 12% OFF + 275 loyalty points
Thr580–Gly685
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RNF6 Protein, N-His-SUMO

Product name ARO-P11990-100
Uniprot ID Q9Y252
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSELGKICSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANNG
Molecular weight 24.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr580-Gly685
Aliases /Synonyms RNF6, E3 ubiquitin-protein ligase RNF6, SPG2, RING-type E3 ubiquitin transferase RNF6
Reference ARO-P11990
Note For research use only.
Molecular Constructor
Thr580–Gly685
Product name ARO-P11990-1MG
Uniprot ID Q9Y252
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSELGKICSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANNG
Molecular weight 24.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr580-Gly685
Aliases /Synonyms RNF6, E3 ubiquitin-protein ligase RNF6, SPG2, RING-type E3 ubiquitin transferase RNF6
Reference ARO-P11990
Note For research use only.
Molecular Constructor
Thr580–Gly685
Product name ARO-P11990-50
Uniprot ID Q9Y252
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSELGKICSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANNG
Molecular weight 24.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr580-Gly685
Aliases /Synonyms RNF6, E3 ubiquitin-protein ligase RNF6, SPG2, RING-type E3 ubiquitin transferase RNF6
Reference ARO-P11990
Note For research use only.
Molecular Constructor
Thr580–Gly685

Introduction to Recombinant Human RNF6 Protein

Recombinant Human RNF6 Protein, also known as Ring Finger Protein 6, is a protein that plays a crucial role in various cellular processes such as cell growth, differentiation, and apoptosis. It is encoded by the RNF6 gene, located on chromosome X in humans. This protein belongs to the RING finger family of proteins, which are involved in ubiquitin-mediated protein degradation and regulation of signaling pathways.

Structure of Recombinant Human RNF6 Protein

The Recombinant Human RNF6 Protein is composed of 215 amino acids and has a molecular weight of approximately 24 kDa. It contains a conserved N-terminal RING finger domain, which is responsible for its E3 ubiquitin ligase activity. This domain is characterized by a cysteine-rich motif that binds to two zinc ions and is involved in the transfer of ubiquitin molecules to target proteins.

The RING finger domain is followed by a coiled-coil region, which is responsible for protein-protein interactions. This region also contains a nuclear localization signal, indicating the potential role of RNF6 in nuclear processes. The C-terminal region of the protein contains a proline-rich domain, which is involved in binding to SH3 domain-containing proteins and regulating cell signaling pathways.

Activity of Recombinant Human RNF6 Protein

Recombinant Human RNF6 Protein has been shown to have E3 ubiquitin ligase activity, which is essential for the regulation of protein degradation. It catalyzes the transfer of ubiquitin molecules to target proteins, marking them for degradation by the proteasome. This process is crucial for maintaining cellular homeostasis and regulating various signaling pathways.

Moreover, RNF6 has been found to interact with several proteins involved in cell growth and differentiation, such as SMAD4, p53, and TGF-β. It has also been shown to play a role in the regulation of androgen receptor signaling, which is important for prostate cancer progression.

Application of Recombinant Human RNF6 Protein

The use of Recombinant Human RNF6 Protein has been widely studied in various research fields, including cancer biology, cell signaling, and protein degradation. Its E3 ubiquitin ligase activity makes it a potential target for drug development, particularly in cancer therapy.

Studies have shown that RNF6 is overexpressed in several types of cancer, including prostate, breast, and lung cancer. Inhibition of RNF6 has been found to suppress tumor growth and sensitize cancer cells to chemotherapy. Therefore, targeting RNF6 could be a promising strategy for cancer treatment.

In addition, Recombinant Human RNF6 Protein has been used in studies investigating the role of RNF6 in cell signaling pathways. It has been shown to regulate the activity of SMAD4, a key mediator of TGF-β signaling, and p53, a tumor suppressor protein. Understanding the mechanisms of RNF6 in these pathways could lead to the development of novel therapies for diseases such as cancer and fibrosis.

Furthermore, the use of Recombinant Human RNF6 Protein in protein degradation studies has provided valuable insights into the regulation of cellular processes. Its E3 ubiquitin ligase activity has been utilized to study the degradation of specific target proteins and their role in various cellular functions.

Conclusion

Recombinant Human RNF6 Protein is a crucial protein involved in cellular processes such as cell growth, differentiation, and apoptosis. Its structure, E3 ubiquitin ligase activity, and interactions with other proteins make it a promising target for drug development and a valuable tool for studying cell signaling and protein degradation. Further research on the role of RNF6 in various diseases could lead to the development of novel therapies and treatments.

Recombinant Human RNF6 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human RNF6 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products