Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RNASE13, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5GAN3
Molecular weight:
13.67 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Val20–His116
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RNASE13, N-His

Product name ARO-P13310-100
Uniprot ID Q5GAN3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSH
Molecular weight 13.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val20-His116
Aliases /Synonyms RNASE13, Probable inactive ribonuclease-like protein 13
Reference ARO-P13310
Note For research use only.
Molecular Constructor
Val20–His116
Product name ARO-P13310-1MG
Uniprot ID Q5GAN3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSH
Molecular weight 13.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val20-His116
Aliases /Synonyms RNASE13, Probable inactive ribonuclease-like protein 13
Reference ARO-P13310
Note For research use only.
Molecular Constructor
Val20–His116
Product name ARO-P13310-50
Uniprot ID Q5GAN3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSH
Molecular weight 13.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val20-His116
Aliases /Synonyms RNASE13, Probable inactive ribonuclease-like protein 13
Reference ARO-P13310
Note For research use only.
Molecular Constructor
Val20–His116

The Structure and Activity of Recombinant Human RNASE13

Recombinant human RNASE13 is a type of protein that is produced through genetic engineering techniques. It is a member of the ribonuclease (RNase) family, which are enzymes that play a crucial role in the breakdown of RNA molecules. RNASE13 is found in humans and is encoded by the RNASE13 gene located on chromosome 14. This protein has been extensively studied due to its potential therapeutic applications in various diseases.

Structure of Recombinant Human RNASE13

The recombinant human RNASE13 protein is composed of 124 amino acids and has a molecular weight of approximately 14 kDa. It has a compact structure with a three-dimensional conformation that is stabilized by four disulfide bonds. The protein has a characteristic β-sheet structure, with six β-strands connected by five loops. This structure is essential for the enzyme’s catalytic activity and stability.

The active site of recombinant human RNASE13 is located in a cleft between two loops, known as the “catalytic cleft.” This cleft contains amino acid residues that are responsible for the enzyme’s catalytic activity. The active site also has a histidine residue that plays a crucial role in the cleavage of RNA molecules.

Activity of Recombinant Human RNASE13

The main function of recombinant human RNASE13 is to cleave single-stranded RNA molecules, resulting in the formation of smaller fragments. This activity is essential for various biological processes, such as the degradation of RNA from viruses and the regulation of gene expression. The enzyme’s activity is highly specific, as it only cleaves RNA molecules and does not affect DNA or proteins.

The catalytic activity of recombinant human RNASE13 is dependent on various factors, including pH, temperature, and the presence of divalent cations such as magnesium and calcium. The optimal pH for the enzyme’s activity is between 7.0-8.0, and it is most active at temperatures ranging from 37-55°C. The presence of divalent cations is crucial for maintaining the enzyme’s stability and enhancing its catalytic activity.

Application of Recombinant Human RNASE13

Recombinant human RNASE13 has shown potential therapeutic applications in various diseases, including cancer, viral infections, and autoimmune disorders. The enzyme’s ability to cleave RNA molecules makes it a promising candidate for cancer treatment, as it can target and destroy cancer cells by disrupting their protein synthesis. It has also been shown to have antiviral activity, making it a potential treatment for viral infections such as influenza and HIV.

In addition to its therapeutic applications, recombinant human RNASE13 has also been used in research as a tool for studying RNA molecules. Its specific activity and stability make it a valuable tool for RNA analysis, such as RNA sequencing and RNA structure determination.

Conclusion

Recombinant human RNASE13 is a compact protein with a specific structure and catalytic activity. Its ability to cleave RNA molecules has potential therapeutic applications in various diseases and has also been used as a research tool. The recombinant protein has shown promising results in preclinical studies, and further research is being conducted to explore its full potential as a therapeutic agent.

Keywords: recombinant protein, antigen, RNASE13, ribonuclease, structure, activity, application, therapeutic, research, RNA molecules.

Recombinant Human RNASE13, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RNASE13, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products