Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RHOT2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IXI1
Molecular weight:
47.78 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Glu177–Phe589
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RHOT2 Protein, N-His

Product name ARO-P12405-100
Uniprot ID Q8IXI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Molecular weight 47.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Phe589
Aliases /Synonyms Ras homolog gene family member T2, MIRO-2, ARHT2, hMiro-2, Mitochondrial Rho GTPase 2, C16orf39, RHOT2
Reference ARO-P12405
Note For research use only.
Molecular Constructor
Glu177–Phe589
Product name ARO-P12405-1MG
Uniprot ID Q8IXI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Molecular weight 47.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Phe589
Aliases /Synonyms Ras homolog gene family member T2, MIRO-2, ARHT2, hMiro-2, Mitochondrial Rho GTPase 2, C16orf39, RHOT2
Reference ARO-P12405
Note For research use only.
Molecular Constructor
Glu177–Phe589
Product name ARO-P12405-50
Uniprot ID Q8IXI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Molecular weight 47.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Phe589
Aliases /Synonyms Ras homolog gene family member T2, MIRO-2, ARHT2, hMiro-2, Mitochondrial Rho GTPase 2, C16orf39, RHOT2
Reference ARO-P12405
Note For research use only.
Molecular Constructor
Glu177–Phe589

Title: Introduction to Recombinant Human RHOT2 Protein
Recombinant Human RHOT2 Protein: Structure and Function
Recombinant Human RHOT2 Protein: Activity and Mechanism
Applications of Recombinant Human RHOT2 Protein

Introduction:
Recombinant Human RHOT2 Protein is a novel protein that has gained significant attention in the field of biomedical research. This protein is a member of the Rho family of GTPases, which play a crucial role in regulating cell signaling and cytoskeletal dynamics. RHOT2 is a mitochondrial Rho GTPase, which is involved in maintaining mitochondrial morphology and function. The recombinant form of this protein has been extensively studied and has shown promising potential in various applications.

Structure and Function:
The recombinant form of RHOT2 protein is produced through genetic engineering techniques, where the gene encoding the protein is inserted into a suitable expression system, such as bacteria or yeast. The resulting protein is identical to its natural counterpart and possesses a similar structure and function. RHOT2 protein consists of a conserved GTPase domain, which is responsible for its GTP binding and hydrolysis activity. It also contains a C-terminal transmembrane domain, which anchors the protein to the mitochondrial membrane.

Activity and Mechanism:
The primary function of RHOT2 protein is to regulate mitochondrial dynamics by controlling the balance between fusion and fission processes. This is achieved through its GTPase activity, where it cycles between an active GTP-bound form and an inactive GDP-bound form. In the active form, RHOT2 interacts with other proteins to promote mitochondrial fusion, while in the inactive form, it promotes mitochondrial fission. This dynamic regulation of mitochondrial morphology is crucial for maintaining cellular homeostasis and has implications in various physiological processes such as cell growth, differentiation, and apoptosis.

Applications:
Recombinant Human RHOT2 Protein has shown promising potential in various applications, making it a valuable tool in biomedical research. One of its primary applications is in studying the role of RHOT2 in mitochondrial dynamics and its implications in diseases such as Parkinson’s and Alzheimer’s. The recombinant protein can be used to manipulate the levels of RHOT2 in cells and study its effects on mitochondrial morphology and function.

Another potential application of recombinant RHOT2 protein is in drug discovery. As mitochondrial dysfunction is a hallmark of many diseases, targeting RHOT2 could be a potential therapeutic strategy. Recombinant RHOT2 protein can be used in high-throughput screening assays to identify small molecules that modulate its activity, which can then be further developed as potential drugs.

Furthermore, recombinant RHOT2 protein has been used in structural studies to elucidate its mechanism of action. The recombinant protein can be purified and used in X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy experiments to determine its three-dimensional structure. This information can aid in understanding the structural basis of RHOT2 function and aid in the design of more potent and specific inhibitors.

Conclusion:
In conclusion, Recombinant Human RHOT2 Protein is a crucial player in regulating mitochondrial dynamics and has potential applications in various fields. Its recombinant form has been extensively studied and has shown promising results in understanding its structure, function, and mechanism. With ongoing research, recombinant RHOT2 protein holds promise in contributing to the development of novel therapeutics for various diseases.

Recombinant Human RHOT2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RHOT2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products