Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RHBDL2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NX52
Molecular weight:
36.35 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Ala2–Pro71
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RHBDL2 Protein, N-GST & C-His

Product name ARO-P10667-100
Uniprot ID Q9NX52
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPP
Molecular weight 36.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Pro71
Aliases /Synonyms CTF, NTF, RRP2, Rhomboid-related protein 2, Rhomboid-like protein 2, RHBDL2
Reference ARO-P10667
Note For research use only.
Molecular Constructor
Ala2–Pro71
Product name ARO-P10667-1MG
Uniprot ID Q9NX52
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPP
Molecular weight 36.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Pro71
Aliases /Synonyms CTF, NTF, RRP2, Rhomboid-related protein 2, Rhomboid-like protein 2, RHBDL2
Reference ARO-P10667
Note For research use only.
Molecular Constructor
Ala2–Pro71
Product name ARO-P10667-50
Uniprot ID Q9NX52
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPP
Molecular weight 36.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Pro71
Aliases /Synonyms CTF, NTF, RRP2, Rhomboid-related protein 2, Rhomboid-like protein 2, RHBDL2
Reference ARO-P10667
Note For research use only.
Molecular Constructor
Ala2–Pro71

Introduction

Recombinant Human RHBDL2 Protein, also known as RHBDF2, is a type II transmembrane protein that belongs to the rhomboid family of serine proteases. It is encoded by the RHBDF2 gene and is expressed in various tissues including the brain, heart, liver, and kidney. RHBDL2 is involved in the cleavage and release of membrane-bound proteins, making it an important player in various cellular processes. In this article, we will delve deeper into the structure, activity, and applications of this protein.

Structure of Recombinant Human RHBDL2 Protein

The gene for RHBDL2 is located on chromosome 17 and consists of 9 exons, which encode for a protein of 293 amino acids. The protein has a predicted molecular weight of approximately 32 kDa and contains a signal peptide, a transmembrane domain, and a catalytic domain. The signal peptide is responsible for directing the protein to the endoplasmic reticulum, where it undergoes post-translational modifications. The transmembrane domain anchors the protein to the cell membrane, while the catalytic domain contains the active site responsible for proteolytic activity.

Activity of Recombinant Human RHBDL2 Protein

RHBDL2 is a serine protease that is involved in the cleavage and release of membrane-bound proteins. It is known to cleave various substrates, including the amyloid precursor protein (APP), which is involved in the pathology of Alzheimer’s disease. RHBDL2 has also been shown to cleave the Notch receptor, a key regulator of cell differentiation and development. This proteolytic activity is essential for the proper functioning of these proteins and is tightly regulated to prevent any aberrant cleavage.

In addition to its role in proteolysis, RHBDL2 has been implicated in other cellular processes. It has been shown to play a role in the regulation of cell proliferation and migration, as well as in the maintenance of cell polarity. Furthermore, RHBDL2 has been found to interact with other proteins, such as the EGF receptor, and modulate their activity, highlighting its diverse functions in the cell.

Applications of Recombinant Human RHBDL2 Protein

The recombinant form of RHBDL2 has been widely used in various research applications. One of the main applications is in the study of the proteolytic activity of this protein. Recombinant RHBDL2 can be used to cleave specific substrates in vitro, providing valuable insights into its activity and regulation. This has been particularly useful in understanding the role of RHBDL2 in the cleavage of amyloid precursor protein and its potential implications in Alzheimer’s disease.

Moreover, recombinant RHBDL2 has been used in the production of monoclonal antibodies. The protein can be used as an antigen to elicit an immune response in animals, leading to the production of antibodies that can be used in various research and diagnostic applications. These antibodies can also be used to study the expression and localization of RHBDL2 in different tissues and cell types.

In addition, RHBDL2 has been identified as a potential therapeutic target in various diseases. For instance, the dysregulation of RHBDL2 has been linked to the progression of certain cancers, making it a potential target for cancer therapy. Furthermore, the role of RHBDL2 in the cleavage of Notch receptor has also sparked interest in its potential as a therapeutic target in diseases involving Notch signaling, such as cardiovascular diseases and developmental disorders.

Conclusion

In summary, Recombinant Human RHBDL2 Protein is a type II transmembrane protein that plays a crucial role in the cleavage and release of membrane-bound proteins. Its structure, activity, and diverse functions make it an important player in various cellular processes. The availability of recombinant RHBDL2 has greatly facilitated its study and has opened up new opportunities for its applications in research and therapeutics

Recombinant Human RHBDL2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human RHBDL2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products