Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RGS17 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UGC6
Molecular weight:
18.49 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Thr74–Ser210
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RGS17 Protein, N-His

Product name ARO-P11762-100
Uniprot ID Q9UGC6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Molecular weight 18.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr74-Ser210
Aliases /Synonyms RGS17, Regulator of G-protein signaling 17, RGSZ2
Reference ARO-P11762
Note For research use only.
Molecular Constructor
Thr74–Ser210
Product name ARO-P11762-1MG
Uniprot ID Q9UGC6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Molecular weight 18.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr74-Ser210
Aliases /Synonyms RGS17, Regulator of G-protein signaling 17, RGSZ2
Reference ARO-P11762
Note For research use only.
Molecular Constructor
Thr74–Ser210
Product name ARO-P11762-50
Uniprot ID Q9UGC6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Molecular weight 18.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr74-Ser210
Aliases /Synonyms RGS17, Regulator of G-protein signaling 17, RGSZ2
Reference ARO-P11762
Note For research use only.
Molecular Constructor
Thr74–Ser210

Title: Introduction to Recombinant Human RGS17 Protein

Recombinant Human RGS17 Protein, also known as Regulator of G protein signaling 17, is a highly conserved protein that plays a crucial role in regulating the activity of G protein-coupled receptors (GPCRs). This protein is encoded by the RGS17 gene and is expressed in various tissues including brain, heart, and kidney. Recombinant Human RGS17 Protein is widely used in research and pharmaceutical applications due to its unique structure and function.

Title: Structure of Recombinant Human RGS17 Protein

Recombinant Human RGS17 Protein is a 30 kDa protein consisting of 261 amino acids. It contains a conserved RGS domain, which is responsible for its regulatory function. This domain is composed of approximately 120 amino acids and is highly conserved among different species. The RGS domain of Recombinant Human RGS17 Protein interacts with the G protein alpha subunit and acts as a GTPase-activating protein (GAP), promoting the hydrolysis of GTP to GDP and thereby terminating the signaling activity of GPCRs.

Title: Activity of Recombinant Human RGS17 Protein

The main function of Recombinant Human RGS17 Protein is to regulate the activity of GPCRs, which are involved in various physiological processes such as vision, taste, and hormone signaling. GPCRs are activated by binding to specific ligands, which triggers a cascade of signaling events. However, prolonged activation of GPCRs can lead to abnormal signaling and contribute to various diseases. Recombinant Human RGS17 Protein acts as a negative regulator of GPCR signaling by accelerating the hydrolysis of GTP and promoting the inactivation of G proteins.

Title: Applications of Recombinant Human RGS17 Protein

Recombinant Human RGS17 Protein has a wide range of applications in both basic research and drug discovery. Due to its role in regulating GPCR signaling, this protein is used in studies related to vision, taste, and hormone signaling. It is also used in drug discovery to screen for potential therapeutics that target GPCRs. In addition, Recombinant Human RGS17 Protein has been implicated in various diseases such as cancer, cardiovascular diseases, and neurological disorders. Therefore, it is a potential target for the development of novel therapeutics.

Title: Production of Recombinant Human RGS17 Protein

Recombinant Human RGS17 Protein is produced using recombinant DNA technology. The RGS17 gene is cloned into an expression vector and then introduced into a suitable host cell, such as E. coli or mammalian cells. The host cells are then cultured and induced to produce large quantities of the protein. The recombinant protein is then purified using various chromatography techniques to obtain a highly pure and active form of Recombinant Human RGS17 Protein.

Title: Antigenicity of Recombinant Human RGS17 Protein

Recombinant Human RGS17 Protein is an antigen, meaning it can induce an immune response in the body. This property makes it a valuable tool in immunological studies and vaccine development. The RGS domain of Recombinant Human RGS17 Protein is highly conserved among different species, making it an ideal antigen for cross-reactivity studies. In addition, the recombinant protein can be used to generate specific antibodies that can be used for detection and quantification of RGS17 in various biological samples.

In conclusion, Recombinant Human RGS17 Protein is a crucial regulator of GPCR signaling and has a wide range of applications in research and drug discovery. Its unique structure and activity make it an important tool in understanding the complex signaling pathways involved in various physiological processes and diseases. With ongoing research, Recombinant Human RGS17 Protein holds great potential for the development of novel therapeutics for various diseases.

Recombinant Human RGS17 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RGS17 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products