Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human REC8 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95072
Molecular weight:
22.49 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Leu470–His547
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human REC8 Protein, N-His-SUMO & C-Strep

Product name ARO-P12353-100
Uniprot ID O95072
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu470-His547
Aliases /Synonyms Cohesin Rec8p, Meiotic recombination protein REC8 homolog, REC8, REC8L1
Reference ARO-P12353
Note For research use only.
Molecular Constructor
Leu470–His547
Product name ARO-P12353-1MG
Uniprot ID O95072
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu470-His547
Aliases /Synonyms Cohesin Rec8p, Meiotic recombination protein REC8 homolog, REC8, REC8L1
Reference ARO-P12353
Note For research use only.
Molecular Constructor
Leu470–His547
Product name ARO-P12353-50
Uniprot ID O95072
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu470-His547
Aliases /Synonyms Cohesin Rec8p, Meiotic recombination protein REC8 homolog, REC8, REC8L1
Reference ARO-P12353
Note For research use only.
Molecular Constructor
Leu470–His547

Introduction

Recombinant proteins have become essential tools in various fields of research, diagnostics, and therapeutics. One such protein is the Recombinant Human REC8 Protein, which has gained significant attention due to its unique structure and diverse applications. In this article, we will explore the structure, activity, and applications of this recombinant protein in detail.

Structure of Recombinant Human REC8 Protein

The Recombinant Human REC8 Protein is a member of the cohesin protein family, which plays a crucial role in chromosome segregation during cell division. It is composed of 627 amino acids and has a molecular weight of approximately 68 kDa. The protein consists of three domains – an N-terminal domain, a central domain, and a C-terminal domain.

Structure of Recombinant Human REC8 Protein

N-terminal Domain

The N-terminal domain of Recombinant Human REC8 Protein is responsible for binding to other cohesin proteins, forming a ring-like structure that encircles the DNA. This domain also interacts with regulatory proteins, which control the activity of the cohesin complex.

Central Domain

The central domain of Recombinant Human REC8 Protein contains a conserved motif known as the “kleisin fold”, which is essential for the stability of the cohesin complex. This domain also plays a crucial role in the interaction between cohesin and DNA, ensuring proper chromosome segregation during cell division.

C-terminal Domain

The C-terminal domain of Recombinant Human REC8 Protein is responsible for binding to the protein SMC3, forming a heterodimer that is essential for the function of the cohesin complex. This domain also contains a highly conserved motif known as the “STAG” domain, which is involved in regulating the activity of the cohesin complex.

Activity of Recombinant Human REC8 Protein

The main function of Recombinant Human REC8 Protein is to regulate chromosome segregation during cell division. It does so by forming a ring-like structure with other cohesin proteins, which encircles the DNA and holds sister chromatids together until they are ready to be separated during cell division. This process is critical for maintaining the integrity of the genome and preventing chromosomal abnormalities.

In addition to its role in cell division, Recombinant Human REC8 Protein has also been shown to play a role in DNA repair. It has been found to interact with other proteins involved in DNA repair, suggesting that it may have a role in maintaining genomic stability.

Applications of Recombinant Human REC8 Protein

Due to its unique structure and activity, Recombinant Human REC8 Protein has a wide range of applications in various fields of research, diagnostics, and therapeutics.

Research

Recombinant Human REC8 Protein is commonly used in research to study the mechanisms of chromosome segregation and DNA repair. It is also used to investigate the role of cohesin proteins in various cellular processes and to identify potential therapeutic targets for diseases associated with chromosomal abnormalities.

Diagnostics

Recombinant Human REC8 Protein has been used in diagnostic tests to detect chromosomal abnormalities, such as chromosomal translocations, which are associated with various types of cancer. It has also been used to identify mutations in the genes that code for cohesin proteins, which can lead to developmental disorders such as Cornelia de Lange syndrome.

Ther

Recombinant Human REC8 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human REC8 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products