Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RARRES2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99969
Molecular weight:
16.93 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Ala33–Lys158
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RARRES2, N-His

Product name ARO-P13144-100
Uniprot ID Q99969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSK
Molecular weight 16.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Lys158
Aliases /Synonyms Chemerin, Retinoic acid receptor responder protein 2, Tazarotene-induced gene 2 protein, RAR-responsive protein TIG2, TIG2, RARRES2
Reference ARO-P13144
Note For research use only.
Molecular Constructor
Ala33–Lys158
Product name ARO-P13144-1MG
Uniprot ID Q99969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSK
Molecular weight 16.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Lys158
Aliases /Synonyms Chemerin, Retinoic acid receptor responder protein 2, Tazarotene-induced gene 2 protein, RAR-responsive protein TIG2, TIG2, RARRES2
Reference ARO-P13144
Note For research use only.
Molecular Constructor
Ala33–Lys158
Product name ARO-P13144-50
Uniprot ID Q99969
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSK
Molecular weight 16.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala33-Lys158
Aliases /Synonyms Chemerin, Retinoic acid receptor responder protein 2, Tazarotene-induced gene 2 protein, RAR-responsive protein TIG2, TIG2, RARRES2
Reference ARO-P13144
Note For research use only.
Molecular Constructor
Ala33–Lys158

Introduction to Recombinant Human RARRES2

Recombinant Human RARRES2, also known as Retinoic Acid Receptor Responder Protein 2, is a protein that is encoded by the RARRES2 gene in humans. This gene is located on chromosome 7 and is involved in the regulation of various cellular processes, such as cell growth, differentiation, and apoptosis. Recombinant Human RARRES2 is a synthetic form of this protein that is produced through genetic engineering techniques, making it an important tool in scientific research and medical applications.

Structure of Recombinant Human RARRES2

The structure of Recombinant Human RARRES2 is composed of 135 amino acids, with a molecular weight of approximately 15 kDa. It contains a conserved cysteine-rich domain, which is believed to play a role in protein-protein interactions. This domain is essential for the binding of RARRES2 to its receptor, the retinoic acid receptor (RAR), and is therefore crucial for its biological activity.

Recombinant Human RARRES2 also contains a signal peptide at its N-terminus, which is responsible for directing the protein to the endoplasmic reticulum for proper folding and post-translational modifications. These modifications, such as glycosylation, ensure the stability and functionality of the protein.

Activity of Recombinant Human RARRES2

Recombinant Human RARRES2 is a multifunctional protein that has been shown to have various activities in different biological processes. One of its main functions is its role as a retinoic acid-responsive gene, which is activated by retinoic acid (RA) binding to its receptor RAR. This activation leads to the upregulation of RARRES2 expression, which in turn induces cell differentiation and inhibits cell proliferation.

In addition to its role in cell growth and differentiation, Recombinant Human RARRES2 has also been found to have anti-inflammatory and anti-tumor properties. It has been shown to inhibit the production of pro-inflammatory cytokines and chemokines, as well as suppress the growth and invasion of cancer cells. This makes it a potential therapeutic target for diseases such as cancer and inflammatory disorders.

Application of Recombinant Human RARRES2

The unique structure and activity of Recombinant Human RARRES2 make it a valuable tool in various scientific and medical applications. One of its main uses is in studying the role of RARRES2 in different biological processes. By overexpressing or silencing the gene that encodes this protein, researchers can better understand its function and potential therapeutic implications.

Recombinant Human RARRES2 is also used in drug discovery and development. Its ability to inhibit cell proliferation and induce differentiation makes it a potential target for anti-cancer drugs. Additionally, its anti-inflammatory properties make it a promising candidate for the treatment of inflammatory diseases, such as rheumatoid arthritis and psoriasis.

Furthermore, Recombinant Human RARRES2 has diagnostic applications. It has been found to be upregulated in certain types of cancer, such as breast and lung cancer, making it a potential biomarker for early detection and monitoring of these diseases.

Conclusion

In summary, Recombinant Human RARRES2 is a synthetic form of the RARRES2 protein that has a conserved cysteine-rich domain and a signal peptide for proper folding and post-translational modifications. It has various activities, including its role as a retinoic acid-responsive gene, anti-inflammatory and anti-tumor properties. This makes it a valuable tool in scientific research and has potential applications in drug development and diagnostics. Further studies on this protein may lead to new insights and advancements in various fields of medicine.

Recombinant Human RARRES2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RARRES2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products