Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB22A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UL26
Molecular weight:
21.49 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Met1–Ala171
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB22A Protein, N-His

Product name ARO-P12438-100
Uniprot ID Q9UL26
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDA
Molecular weight 21.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala171
Aliases /Synonyms RAB22A, RAB22, Ras-related protein Rab-22A, Rab-22
Reference ARO-P12438
Note For research use only.
Molecular Constructor
Met1–Ala171
Product name ARO-P12438-1MG
Uniprot ID Q9UL26
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDA
Molecular weight 21.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala171
Aliases /Synonyms RAB22A, RAB22, Ras-related protein Rab-22A, Rab-22
Reference ARO-P12438
Note For research use only.
Molecular Constructor
Met1–Ala171
Product name ARO-P12438-50
Uniprot ID Q9UL26
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDA
Molecular weight 21.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala171
Aliases /Synonyms RAB22A, RAB22, Ras-related protein Rab-22A, Rab-22
Reference ARO-P12438
Note For research use only.
Molecular Constructor
Met1–Ala171

Introduction

Recombinant Human RAB22A Protein is a type of protein that is produced through genetic engineering techniques, also known as recombinant protein. This protein belongs to the RAB family of small GTPases, which are essential for regulating intracellular membrane trafficking and vesicle transport. In this article, we will discuss the structure, activity, and applications of Recombinant Human RAB22A Protein.

Structure

Recombinant Human RAB22A Protein is composed of 185 amino acids and has a molecular weight of approximately 21 kDa. It contains a conserved GTP-binding domain and a C-terminal hypervariable region that is responsible for its membrane localization. The protein also has a lipid modification site at the C-terminus, which allows it to anchor to the membrane.

Activity

Recombinant Human RAB22A Protein is involved in the regulation of endocytic and exocytic pathways, as well as the transport of proteins and lipids between different cellular compartments. It functions as a molecular switch, cycling between an active GTP-bound form and an inactive GDP-bound form. This activity is regulated by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs).

Studies have shown that Recombinant Human RAB22A Protein plays a crucial role in the formation and maintenance of the endosomal network, which is responsible for sorting and trafficking of proteins and lipids. It also regulates the fusion of endosomes with other organelles, such as lysosomes and the plasma membrane.

Applications

Recombinant Human RAB22A Protein has a wide range of applications in both research and therapeutic fields. Some of the key applications include:

1. Cell Biology Research

Recombinant Human RAB22A Protein is commonly used in cell biology research to study the mechanisms of intracellular membrane trafficking and vesicle transport. Its activity can be modulated by various GEFs and GAPs, allowing researchers to investigate the specific functions of this protein in different cellular processes.

2. Cancer Research

Abnormal expression and activity of RAB22A have been linked to various types of cancer, making it a potential target for cancer therapy. Recombinant Human RAB22A Protein can be used to study the role of this protein in cancer development and progression, as well as to screen for potential inhibitors that can disrupt its activity and inhibit cancer growth.

3. Drug Targeting and Delivery

Recombinant Human RAB22A Protein has been shown to play a crucial role in the delivery of drugs and other therapeutic agents to specific cellular compartments. By understanding its activity and mechanisms of action, researchers can develop targeted drug delivery systems that can improve the efficacy and reduce the side effects of various medications.

4. Vaccine Development

Recombinant Human RAB22A Protein has also been identified as a potential antigen for vaccine development. It is highly conserved among different species and has been shown to elicit a strong immune response in animal studies. This makes it a promising candidate for the development of vaccines against infectious diseases.

Conclusion

In summary, Recombinant Human RAB22A Protein is a crucial component of the cellular machinery that regulates intracellular membrane trafficking and vesicle transport. Its structure and activity have been extensively studied, and it has a wide range of applications in cell biology research, cancer therapy, drug targeting, and vaccine development. Further research on this protein may reveal new insights into its functions

Recombinant Human RAB22A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB22A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products