Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB18 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP72
Molecular weight:
22.89 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Met1–Lys183
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB18 Protein, N-His

Product name ARO-P12364-100
Uniprot ID Q9NP72
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNK
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys183
Aliases /Synonyms Ras-related protein Rab-18, RAB18
Reference ARO-P12364
Note For research use only.
Molecular Constructor
Met1–Lys183
Product name ARO-P12364-1MG
Uniprot ID Q9NP72
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNK
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys183
Aliases /Synonyms Ras-related protein Rab-18, RAB18
Reference ARO-P12364
Note For research use only.
Molecular Constructor
Met1–Lys183
Product name ARO-P12364-50
Uniprot ID Q9NP72
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNK
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys183
Aliases /Synonyms Ras-related protein Rab-18, RAB18
Reference ARO-P12364
Note For research use only.
Molecular Constructor
Met1–Lys183

Introduction
Recombinant Human RAB18 Protein is a highly conserved member of the Ras superfamily of small GTPases. It plays a crucial role in intracellular trafficking and vesicle formation, making it an essential protein for various cellular processes. In this article, we will discuss the structure, activity, and applications of Recombinant Human RAB18 Protein.

Structure of Recombinant Human RAB18 Protein
The human RAB18 gene is located on chromosome 10 and encodes a protein of 204 amino acids. The protein has a molecular weight of approximately 23 kDa and is composed of five distinct regions: the N-terminal domain, the switch I and II regions, the effector domain, and the C-terminal hypervariable region. The N-terminal domain is responsible for binding to guanine nucleotides, while the switch I and II regions undergo conformational changes upon GTP binding, which regulates the activity of the protein. The effector domain interacts with downstream effector molecules, and the C-terminal hypervariable region is involved in membrane targeting and protein-protein interactions.

Activity of Recombinant Human RAB18 Protein
RAB18 is primarily involved in regulating membrane trafficking and vesicle formation. It is localized to the Golgi complex, endosomes, and lipid droplets, where it plays a crucial role in maintaining the balance of lipid metabolism. RAB18 has been shown to interact with various effector proteins, such as the lipid droplet-associated protein ADRP, the Golgi-associated protein GRASP55, and the endosomal protein VARP, to regulate vesicle trafficking and fusion. Additionally, RAB18 has been implicated in autophagy, a process that degrades and recycles cellular components, by regulating the formation of autophagosomes.

Applications of Recombinant Human RAB18 Protein
Recombinant Human RAB18 Protein has numerous applications in both basic research and therapeutic development. One of the most significant applications of RAB18 is in the study of lipid metabolism and associated disorders. RAB18 has been linked to various lipid-related diseases, such as obesity, diabetes, and atherosclerosis. Recombinant RAB18 protein can be used to study the role of RAB18 in these diseases and potentially identify novel therapeutic targets.

Another potential application of Recombinant Human RAB18 Protein is in the development of targeted drug delivery systems. As RAB18 is involved in vesicle formation and trafficking, it can be utilized to design targeted drug carriers that can deliver drugs specifically to the desired site of action. This could potentially reduce the side effects of drugs and increase their efficacy.

Furthermore, Recombinant Human RAB18 Protein can be used as an antigen in the production of monoclonal antibodies for diagnostic and therapeutic purposes. As RAB18 is highly conserved across species, recombinant protein can be used to generate antibodies that can recognize RAB18 in various organisms. These antibodies can be used in diagnostic tests to detect the presence of RAB18 in patient samples or in therapeutic applications to target RAB18 in disease states.

Conclusion
In conclusion, Recombinant Human RAB18 Protein is a crucial protein involved in various cellular processes, including membrane trafficking and lipid metabolism. Its structure and activity make it an essential protein for both basic research and therapeutic development. With its potential applications in the study of lipid-related diseases, drug delivery, and antibody production, Recombinant Human RAB18 Protein holds great promise in advancing our understanding of cellular processes and improving human health.

Recombinant Human RAB18 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB18 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products