Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB12 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6IQ22
Molecular weight:
21.61 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Asp40–Lys207
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB12 Protein, N-His

Product name ARO-P12270-100
Uniprot ID Q6IQ22
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK
Molecular weight 21.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Lys207
Aliases /Synonyms RAB12, Ras-related protein Rab-12
Reference ARO-P12270
Note For research use only.
Molecular Constructor
Asp40–Lys207
Product name ARO-P12270-1MG
Uniprot ID Q6IQ22
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK
Molecular weight 21.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Lys207
Aliases /Synonyms RAB12, Ras-related protein Rab-12
Reference ARO-P12270
Note For research use only.
Molecular Constructor
Asp40–Lys207
Product name ARO-P12270-50
Uniprot ID Q6IQ22
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK
Molecular weight 21.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Lys207
Aliases /Synonyms RAB12, Ras-related protein Rab-12
Reference ARO-P12270
Note For research use only.
Molecular Constructor
Asp40–Lys207

Introduction

Recombinant Human RAB12 Protein is a type of protein that is produced through genetic engineering techniques. It is a highly purified form of the human RAB12 protein, which plays an important role in cellular processes such as membrane trafficking, cell signaling, and cytoskeleton organization. This protein has gained significant attention in the scientific community due to its potential therapeutic and diagnostic applications in various diseases.

Structure of Recombinant Human RAB12 Protein

The recombinant human RAB12 protein is composed of 203 amino acids and has a molecular weight of approximately 23 kDa. It belongs to the RAS superfamily of small GTPases and shares a high sequence homology with other members of the RAB family. The protein contains a conserved GTP-binding domain and a C-terminal hypervariable region that is responsible for its specific interactions with other proteins and membranes.

Activity of Recombinant Human RAB12 Protein

The main function of RAB12 protein is to regulate vesicle trafficking and fusion in cells. It is involved in the transport of molecules between different cellular compartments, including the Golgi apparatus, endosomes, and plasma membrane. This protein acts as a molecular switch, cycling between an active GTP-bound form and an inactive GDP-bound form. The GTP-bound form of RAB12 interacts with effector proteins, leading to the recruitment of specific vesicles to their target membranes. This process is crucial for the proper functioning of various cellular processes, such as nutrient uptake, hormone secretion, and neurotransmitter release.

Application of Recombinant Human RAB12 Protein

The recombinant human RAB12 protein has a wide range of applications in both research and clinical settings. Some of its key applications are:

1. Recombinant Protein Production

The recombinant human RAB12 protein is commonly used in the production of other recombinant proteins. It can be expressed in various host systems, such as bacteria, yeast, and mammalian cells, and can be easily purified due to its small size and high solubility. This makes it an ideal candidate for use as a fusion partner in protein expression and purification processes.

2. Antigen for Antibody Production

Recombinant human RAB12 protein can also be used as an antigen to produce specific antibodies. These antibodies can then be used for various research purposes, including protein detection, localization, and quantification. They can also be used in diagnostic assays for diseases that are associated with RAB12 protein dysfunction.

3. Drug Target for Neurological Disorders

Recent studies have shown that RAB12 protein plays a crucial role in the pathogenesis of neurodegenerative disorders, such as Parkinson’s disease and Alzheimer’s disease. Therefore, the recombinant human RAB12 protein can be used as a drug target for the development of potential therapeutics to treat these disorders. Inhibition of RAB12 activity has been shown to improve the symptoms and delay the progression of these diseases.

4. Biomarker for Cancer

RAB12 protein has been identified as a potential biomarker for various types of cancer, including breast cancer, colorectal cancer, and lung cancer. Elevated levels of RAB12 have been found in cancer cells, and its overexpression has been linked to tumor growth and metastasis. The recombinant human RAB12 protein can be used in diagnostic tests to detect cancer and monitor its progression.

5. Research Tool for Cell Biology Studies

Recombinant human RAB12 protein is a valuable tool for studying various cellular processes

Recombinant Human RAB12 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB12 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products