Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PSMC1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62191
Molecular weight:
51.49 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
His Met1–Leu440
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PSMC1, N-His

Product name ARO-P13585-100
Uniprot ID P62191
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
Molecular weight 51.49 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu440
Aliases /Synonyms P26s4, 26S proteasome regulatory subunit 4, Proteasome 26S subunit ATPase 1, PSMC1, 26S proteasome AAA-ATPase subunit RPT2
Reference ARO-P13585
Note For research use only.
Molecular Constructor
His Met1–Leu440
Product name ARO-P13585-1MG
Uniprot ID P62191
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
Molecular weight 51.49 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu440
Aliases /Synonyms P26s4, 26S proteasome regulatory subunit 4, Proteasome 26S subunit ATPase 1, PSMC1, 26S proteasome AAA-ATPase subunit RPT2
Reference ARO-P13585
Note For research use only.
Molecular Constructor
His Met1–Leu440
Product name ARO-P13585-50
Uniprot ID P62191
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL
Molecular weight 51.49 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu440
Aliases /Synonyms P26s4, 26S proteasome regulatory subunit 4, Proteasome 26S subunit ATPase 1, PSMC1, 26S proteasome AAA-ATPase subunit RPT2
Reference ARO-P13585
Note For research use only.
Molecular Constructor
His Met1–Leu440

Introduction

Recombinant Human PSMC1, also known as 26S proteasome regulatory subunit 4, is a protein that plays a crucial role in the functioning of the 26S proteasome complex. This complex is responsible for the degradation of damaged or unwanted proteins in the cell, making it an essential component of cellular homeostasis. Recombinant Human PSMC1 is a synthetic version of the protein produced through genetic engineering techniques, making it a valuable tool in various scientific research and applications.

Structure of Recombinant Human PSMC1

Recombinant Human PSMC1 is a 51 kDa protein consisting of 450 amino acids. It belongs to the AAA (ATPases associated with diverse cellular activities) family of proteins and contains six distinct domains – N-terminal domain, coiled-coil domain, AAA domain, linker domain, C-terminal domain, and a C-terminal tail. These domains work together to form a ring-shaped structure, which is essential for the function of the 26S proteasome complex.

Activity of Recombinant Human PSMC1

The primary function of Recombinant Human PSMC1 is to act as a regulatory subunit of the 26S proteasome complex. It recognizes and binds to ubiquitinated proteins, marking them for degradation. The AAA domain of PSMC1 is responsible for ATPase activity, which provides the energy required for the proteasome complex to unfold and degrade the targeted proteins. Additionally, Recombinant Human PSMC1 also plays a role in the assembly and stability of the 26S proteasome complex.

Applications of Recombinant Human PSMC1

Studying Protein Degradation

Recombinant Human PSMC1 is widely used in research to study the mechanism of protein degradation in the cell. It can be used to investigate the role of the 26S proteasome complex in various cellular processes, such as cell cycle regulation, DNA repair, and immune response. Its ability to recognize and bind to ubiquitinated proteins makes it a valuable tool in understanding the specificity of protein degradation.

Drug Discovery

The 26S proteasome complex is a target for many drugs, particularly in the treatment of cancer. Recombinant Human PSMC1 can be used to screen potential drug candidates that can inhibit the activity of the proteasome complex. This can aid in the development of new and more effective drugs for the treatment of various diseases.

Antigen for Antibody Production

Recombinant Human PSMC1 can also be used as an antigen to produce specific antibodies. These antibodies can then be used in various immunoassays to detect the presence of PSMC1 in different samples. This is particularly useful in diagnosing diseases that are associated with dysregulation of the 26S proteasome complex.

Biotechnology Applications

Recombinant Human PSMC1 is also used in biotechnology applications, such as protein purification and production. It can be expressed in various expression systems, including bacteria, yeast, and mammalian cells, to produce large quantities of the protein for research or commercial purposes.

Diagnostic Tool

Abnormalities in the expression or function of the 26S proteasome complex have been linked to various diseases, including cancer and neurodegenerative disorders. Recombinant Human PSMC1 can be used as a diagnostic tool to detect these abnormalities in patient samples, aiding in the early detection and treatment of these diseases.

Therapeutic Agent

Recombinant Human PSMC1 has also shown potential as a therapeutic agent for certain diseases. Studies have shown that it can inhibit the growth of

SDS-PAGE for Recombinant Human PSMC1, N-His

SDS-PAGE for Recombinant Human PSMC1, N-His

Recombinant Human PSMC1, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human PSMC1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PSMC1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products