Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PPT1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P50897
Molecular weight:
32.90 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Leu35–Gly306
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PPT1 Protein, N-His

Product name ARO-P11510-100
Uniprot ID P50897
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG
Molecular weight 32.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Gly306
Aliases /Synonyms PPT-1, Palmitoyl-protein hydrolase 1, CLN1, PPT, PPT1, Palmitoyl-protein thioesterase 1
Reference ARO-P11510
Note For research use only.
Molecular Constructor
Leu35–Gly306
Product name ARO-P11510-1MG
Uniprot ID P50897
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG
Molecular weight 32.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Gly306
Aliases /Synonyms PPT-1, Palmitoyl-protein hydrolase 1, CLN1, PPT, PPT1, Palmitoyl-protein thioesterase 1
Reference ARO-P11510
Note For research use only.
Molecular Constructor
Leu35–Gly306
Product name ARO-P11510-50
Uniprot ID P50897
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLG
Molecular weight 32.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu35-Gly306
Aliases /Synonyms PPT-1, Palmitoyl-protein hydrolase 1, CLN1, PPT, PPT1, Palmitoyl-protein thioesterase 1
Reference ARO-P11510
Note For research use only.
Molecular Constructor
Leu35–Gly306

Introduction

Recombinant Human PPT1 Protein, also known as palmitoyl-protein thioesterase 1, is a type of enzyme that plays a crucial role in the breakdown of fatty acids in the body. This protein is encoded by the PPT1 gene and is found in various tissues, including the brain, heart, and liver. In this article, we will discuss the structure, activity, and applications of Recombinant Human PPT1 Protein.

Structure of Recombinant Human PPT1 Protein

Recombinant Human PPT1 Protein is a 32 kDa protein consisting of 306 amino acids. It belongs to the family of thioesterases, which are enzymes that catalyze the hydrolysis of thioester bonds. The crystal structure of this protein has been determined, revealing a compact globular structure with a central β-sheet surrounded by α-helices. The active site of PPT1 is located at the interface of two domains, the N-terminal and C-terminal domains, and is highly conserved among different species.

Activity of Recombinant Human PPT1 Protein

The main function of Recombinant Human PPT1 Protein is to catalyze the cleavage of thioester bonds between fatty acids and cysteine residues on target proteins. This activity is essential for the proper functioning of various cellular processes, including lipid metabolism and protein trafficking. PPT1 is highly specific for palmitoylated proteins, which are important for the localization and function of many membrane-associated proteins. Defects in PPT1 activity can lead to the accumulation of unprocessed palmitoylated proteins, resulting in various neurodegenerative disorders such as infantile neuronal ceroid lipofuscinosis (INCL).

Applications of Recombinant Human PPT1 Protein

Recombinant Human PPT1 Protein has various applications in both research and therapeutic settings. One of the main uses of this protein is in the study of neurodegenerative diseases. Mutations in the PPT1 gene have been linked to the development of INCL, a rare and fatal neurodegenerative disorder that primarily affects children. Recombinant Human PPT1 Protein can be used to study the structure and function of PPT1 and its role in the pathogenesis of INCL.

Another application of Recombinant Human PPT1 Protein is in drug discovery. As PPT1 plays a crucial role in lipid metabolism and protein trafficking, it has been identified as a potential target for the treatment of various diseases, including cancer and metabolic disorders. Recombinant Human PPT1 Protein can be used in high-throughput screening assays to identify compounds that can modulate its activity, providing a starting point for the development of new therapies.

Furthermore, Recombinant Human PPT1 Protein can also be used in diagnostic tests. The detection of PPT1 activity or levels in biological samples can be used as a biomarker for certain diseases, such as INCL and other neurodegenerative disorders. This can aid in early diagnosis and monitoring of disease progression.

Conclusion

In summary, Recombinant Human PPT1 Protein is a crucial enzyme involved in the breakdown of fatty acids in the body. Its structure, activity, and applications make it a valuable tool in the study of neurodegenerative diseases, drug discovery, and diagnostic tests. Further research on this protein may provide insights into its role in various cellular processes and lead to the development of new therapies for diseases associated with PPT1 dysfunction.

Recombinant Human PPT1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PPT1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products