Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human POU4F3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15319
Molecular weight:
20.15 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Ser182–His338
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human POU4F3 Protein, N-His

Product name ARO-P12078-100
Uniprot ID Q15319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Molecular weight 20.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser182-His338
Aliases /Synonyms Brn-3C, Brain-3C, Brain-specific homeobox/POU domain protein 3C, POU4F3, BRN3C, POU domain, class 4, transcription factor 3
Reference ARO-P12078
Note For research use only.
Molecular Constructor
Ser182–His338
Product name ARO-P12078-1MG
Uniprot ID Q15319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Molecular weight 20.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser182-His338
Aliases /Synonyms Brn-3C, Brain-3C, Brain-specific homeobox/POU domain protein 3C, POU4F3, BRN3C, POU domain, class 4, transcription factor 3
Reference ARO-P12078
Note For research use only.
Molecular Constructor
Ser182–His338
Product name ARO-P12078-50
Uniprot ID Q15319
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH
Molecular weight 20.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser182-His338
Aliases /Synonyms Brn-3C, Brain-3C, Brain-specific homeobox/POU domain protein 3C, POU4F3, BRN3C, POU domain, class 4, transcription factor 3
Reference ARO-P12078
Note For research use only.
Molecular Constructor
Ser182–His338

Introduction

Recombinant Human POU4F3 Protein is a genetically engineered protein that is produced using recombinant DNA technology. This protein belongs to the POU-domain family of transcription factors and is also known as Brn-3c. It plays a crucial role in the development and function of sensory neurons and is a potential therapeutic target for various sensory disorders. In this article, we will discuss the structure, activity, and applications of Recombinant Human POU4F3 Protein.

Structure of Recombinant Human POU4F3 Protein

The POU4F3 gene is located on chromosome 5q32 and encodes for a protein of 373 amino acids. The recombinant protein is produced by inserting the POU4F3 gene into a suitable expression vector and then expressing it in a host cell, usually E. coli or mammalian cells. The resulting protein has a molecular weight of approximately 41 kDa.

The structure of Recombinant Human POU4F3 Protein is characterized by two distinct domains, the POU-specific domain and the POU-homeodomain. The POU-specific domain is responsible for DNA binding, while the POU-homeodomain is responsible for protein-protein interactions. These domains are connected by a flexible linker region, allowing for conformational changes and interactions with other proteins.

Activity of Recombinant Human POU4F3 Protein

Recombinant Human POU4F3 Protein is a transcription factor that regulates the expression of genes involved in sensory neuron development and function. It binds to specific DNA sequences in the promoter regions of target genes and activates or represses their transcription.

Studies have shown that mutations in the POU4F3 gene can lead to various sensory disorders, such as sensorineural hearing loss, vestibular dysfunction, and loss of taste sensation. This highlights the crucial role of POU4F3 in maintaining the proper function of sensory neurons.

Recombinant Human POU4F3 Protein has also been found to play a role in the regeneration of sensory neurons. It promotes the survival and growth of damaged sensory neurons, making it a potential therapeutic target for nerve injuries and degenerative diseases.

Applications of Recombinant Human POU4F3 Protein

Recombinant Human POU4F3 Protein has a wide range of applications in both research and medicine. Some of the key applications include:

  • Studying sensory neuron development: Recombinant Human POU4F3 Protein can be used to study the role of POU4F3 in sensory neuron development. It can be added to cell cultures to observe its effects on gene expression and neuronal differentiation.
  • Drug discovery: As POU4F3 is a potential therapeutic target for sensory disorders, Recombinant Human POU4F3 Protein can be used in drug discovery efforts to develop new treatments for these conditions.
  • Gene therapy: Recombinant Human POU4F3 Protein can be used in gene therapy to deliver functional copies of the POU4F3 gene to patients with mutations in this gene. This can potentially restore the function of sensory neurons and treat sensory disorders.

Conclusion

In summary, Recombinant Human POU4F3 Protein is a crucial protein involved in sensory neuron development and function. Its structure, activity, and applications make it a valuable tool in both research and medicine. Further studies on this protein may lead to a better understanding of sensory disorders and the development of effective treatments.

Recombinant Human POU4F3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human POU4F3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products