Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human PDK1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15118
Molecular weight:
25.04 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Tyr233–Met430
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human PDK1, N-His

Recombinant Human PDK1, N-His

Product name ARO-P13372-100
Uniprot ID Q15118
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDM
Molecular weight 25.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr233-Met430
Aliases /Synonyms PDHK1, [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial, PDK1, Pyruvate dehydrogenase kinase isoform 1, PDH kinase 1
Reference ARO-P13372
Note For research use only.
Molecular Constructor
Tyr233–Met430
Product name ARO-P13372-1MG
Uniprot ID Q15118
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDM
Molecular weight 25.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr233-Met430
Aliases /Synonyms PDHK1, [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial, PDK1, Pyruvate dehydrogenase kinase isoform 1, PDH kinase 1
Reference ARO-P13372
Note For research use only.
Molecular Constructor
Tyr233–Met430
Product name ARO-P13372-50
Uniprot ID Q15118
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDM
Molecular weight 25.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr233-Met430
Aliases /Synonyms PDHK1, [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial, PDK1, Pyruvate dehydrogenase kinase isoform 1, PDH kinase 1
Reference ARO-P13372
Note For research use only.
Molecular Constructor
Tyr233–Met430

Recombinant Human PDK1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PDK1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products