Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PDE4D Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q08499
Molecular weight:
39.26 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Glu391–Thr711
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PDE4D Protein, N-His

Product name ARO-P12387-100
Uniprot ID Q08499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQST
Molecular weight 39.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu391-Thr711
Aliases /Synonyms cAMP-specific 3',5'-cyclic phosphodiesterase 4D, PDE43, PDE4D, DPDE3
Reference ARO-P12387
Note For research use only.
Molecular Constructor
Glu391–Thr711
Product name ARO-P12387-1MG
Uniprot ID Q08499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQST
Molecular weight 39.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu391-Thr711
Aliases /Synonyms cAMP-specific 3',5'-cyclic phosphodiesterase 4D, PDE43, PDE4D, DPDE3
Reference ARO-P12387
Note For research use only.
Molecular Constructor
Glu391–Thr711
Product name ARO-P12387-50
Uniprot ID Q08499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQST
Molecular weight 39.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu391-Thr711
Aliases /Synonyms cAMP-specific 3',5'-cyclic phosphodiesterase 4D, PDE43, PDE4D, DPDE3
Reference ARO-P12387
Note For research use only.
Molecular Constructor
Glu391–Thr711

Introduction

Recombinant Human PDE4D Protein is a highly sought after protein in the field of biotechnology and pharmaceutical research. This protein plays a crucial role in regulating cellular signaling pathways and has been implicated in various diseases, making it an attractive target for drug development. In this article, we will explore the structure, activity, and application of Recombinant Human PDE4D Protein.

Structure of Recombinant Human PDE4D Protein

PDE4D (Phosphodiesterase 4D) is a member of the phosphodiesterase enzyme family, which catalyzes the hydrolysis of cyclic adenosine monophosphate (cAMP) and cyclic guanosine monophosphate (cGMP). The human PDE4D gene is located on chromosome 5q12 and encodes for a protein of 110 kDa. The protein consists of a conserved catalytic domain, regulatory domains, and a C-terminal domain. The catalytic domain contains the active site responsible for the hydrolysis of cAMP and cGMP. The regulatory domains, on the other hand, play a crucial role in regulating the activity of the enzyme. The C-terminal domain is responsible for protein-protein interactions and targeting the enzyme to specific subcellular locations.

Activity of Recombinant Human PDE4D Protein

Recombinant Human PDE4D Protein is a key enzyme involved in the regulation of cAMP signaling pathway. cAMP is a second messenger molecule that plays a crucial role in a wide range of cellular processes, including cell growth, differentiation, and metabolism. PDE4D hydrolyzes cAMP into its inactive form, thus regulating the levels of cAMP in the cell. Dysregulation of cAMP signaling has been implicated in various diseases, including cancer, inflammation, and neurodegenerative disorders. Therefore, PDE4D inhibitors have gained significant attention as potential therapeutic agents for these diseases.

Application of Recombinant Human PDE4D Protein

Recombinant Human PDE4D Protein has diverse applications in both research and drug development. Its role in regulating cAMP signaling makes it a valuable tool for studying various cellular processes. The recombinant protein can be used in biochemical assays to measure PDE4D activity and screen for potential inhibitors. It can also be used in structural studies to understand the mechanism of action of the enzyme and its interactions with potential inhibitors.

In drug development, PDE4D inhibitors have shown promising results in preclinical studies for various diseases. For example, PDE4D inhibitors have been shown to suppress tumor growth and inflammation in animal models of cancer and inflammatory diseases, respectively. Additionally, PDE4D inhibitors have shown potential in treating neurodegenerative disorders such as Alzheimer’s and Parkinson’s disease.

Conclusion

In conclusion, Recombinant Human PDE4D Protein is a vital enzyme involved in the regulation of cAMP signaling pathway. Its structure, activity, and diverse applications make it a valuable tool for both research and drug development. Ongoing studies on PDE4D and its inhibitors hold great promise for the development of novel therapies for various diseases.

Recombinant Human PDE4D Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PDE4D Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products