Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PDCD6IP, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WUM4
Molecular weight:
50.39 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Glu174–Ala383
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PDCD6IP, N-GST

Product name ARO-P13223-100
Uniprot ID Q8WUM4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIA
Molecular weight 50.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu174-Ala383
Aliases /Synonyms ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95, AIP1, ALIX, KIAA1375, PDCD6IP, Programmed cell death 6-interacting protein, PDCD6-interacting protein
Reference ARO-P13223
Note For research use only.
Molecular Constructor
Glu174–Ala383
Product name ARO-P13223-1MG
Uniprot ID Q8WUM4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIA
Molecular weight 50.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu174-Ala383
Aliases /Synonyms ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95, AIP1, ALIX, KIAA1375, PDCD6IP, Programmed cell death 6-interacting protein, PDCD6-interacting protein
Reference ARO-P13223
Note For research use only.
Molecular Constructor
Glu174–Ala383
Product name ARO-P13223-50
Uniprot ID Q8WUM4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIA
Molecular weight 50.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu174-Ala383
Aliases /Synonyms ALG-2-interacting protein 1, ALG-2-interacting protein X, Hp95, AIP1, ALIX, KIAA1375, PDCD6IP, Programmed cell death 6-interacting protein, PDCD6-interacting protein
Reference ARO-P13223
Note For research use only.
Molecular Constructor
Glu174–Ala383

Introduction

Recombinant Human PDCD6IP (Programmed Cell Death 6 Interacting Protein) is a protein that plays a crucial role in regulating cell death and survival pathways. It is a highly conserved protein found in various organisms, including humans. In this article, we will discuss the structure, activity, and applications of Recombinant Human PDCD6IP.

Structure of Recombinant Human PDCD6IP

Recombinant Human PDCD6IP is a 34 kDa protein composed of 295 amino acids. It contains a Phox homology (PX) domain and two calcium-binding EF-hand motifs. The PX domain is responsible for binding to phospholipids, while the EF-hand motifs are involved in calcium-dependent protein-protein interactions. The protein also has a C-terminal coiled-coil domain, which is crucial for its dimerization and interaction with other proteins.

Activity of Recombinant Human PDCD6IP

Recombinant Human PDCD6IP is a multifunctional protein that is involved in various cellular processes, including apoptosis, autophagy, and intracellular signaling. It interacts with several proteins, including Bcl-2, Bax, and Fas, to regulate cell death and survival pathways. It also plays a role in intracellular calcium homeostasis by binding to and regulating the activity of the inositol 1,4,5-trisphosphate receptor (IP3R).

One of the key functions of Recombinant Human PDCD6IP is its role in the regulation of autophagy. Autophagy is a cellular process that involves the degradation and recycling of cellular components to maintain cellular homeostasis. Recombinant Human PDCD6IP interacts with the autophagy-related protein Beclin-1 and plays a crucial role in the initiation of autophagy. It also regulates the fusion of autophagosomes with lysosomes, which is essential for the degradation of autophagic cargo.

Applications of Recombinant Human PDCD6IP

Recombinant Human PDCD6IP has various applications in both research and therapeutic settings. Its role in regulating cell death and survival pathways makes it a potential target for cancer therapy. Studies have shown that overexpression of PDCD6IP can induce apoptosis in cancer cells, making it a potential therapeutic target for cancer treatment.

Recombinant Human PDCD6IP is also used in research to study the mechanisms of autophagy and its role in various diseases. Its interaction with Beclin-1 and regulation of autophagy makes it a crucial protein in understanding the process of autophagy and its dysregulation in diseases such as neurodegenerative disorders and cancer.

Furthermore, Recombinant Human PDCD6IP has been used in studies to understand its role in calcium signaling and its interaction with IP3R. Dysregulation of calcium signaling has been linked to various diseases, and Recombinant Human PDCD6IP provides a valuable tool for studying this process.

Conclusion

Recombinant Human PDCD6IP is a multifunctional protein that plays a crucial role in regulating cell death and survival pathways, autophagy, and intracellular signaling. Its structure, with a PX domain, two EF-hand motifs, and a coiled-coil domain, allows it to interact with various proteins and regulate different cellular processes. Its applications in cancer therapy and research make it a valuable protein for understanding and treating various diseases. Further studies on Recombinant Human PDCD6IP may provide insights into its role in other cellular processes and its potential as a therapeutic target.

Recombinant Human PDCD6IP, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human PDCD6IP, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products