Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PCSK5, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92824
Molecular weight:
39.45 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Asp115–Met454
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PCSK5, N-His

Product name ARO-P13206-100
Uniprot ID Q92824
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVM
Molecular weight 39.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp115-Met454
Aliases /Synonyms PC5, PC6, Proprotein convertase 6, Proprotein convertase subtilisin/kexin type 5, PCSK5, hPC6, Proprotein convertase 5, Subtilisin/kexin-like protease PC5
Reference ARO-P13206
Note For research use only.
Molecular Constructor
Asp115–Met454
Product name ARO-P13206-1MG
Uniprot ID Q92824
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVM
Molecular weight 39.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp115-Met454
Aliases /Synonyms PC5, PC6, Proprotein convertase 6, Proprotein convertase subtilisin/kexin type 5, PCSK5, hPC6, Proprotein convertase 5, Subtilisin/kexin-like protease PC5
Reference ARO-P13206
Note For research use only.
Molecular Constructor
Asp115–Met454
Product name ARO-P13206-50
Uniprot ID Q92824
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVM
Molecular weight 39.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp115-Met454
Aliases /Synonyms PC5, PC6, Proprotein convertase 6, Proprotein convertase subtilisin/kexin type 5, PCSK5, hPC6, Proprotein convertase 5, Subtilisin/kexin-like protease PC5
Reference ARO-P13206
Note For research use only.
Molecular Constructor
Asp115–Met454

Introduction

Recombinant Human PCSK5, also known as Proprotein Convertase Subtilisin/Kexin Type 5, is a type of recombinant protein that plays a crucial role in the regulation of various biological processes. This protein is a member of the proprotein convertase family and is involved in the processing and activation of various proteins, including growth factors, receptors, and enzymes. In this article, we will discuss the structure, activity, and applications of Recombinant Human PCSK5.

Structure of Recombinant Human PCSK5

Recombinant Human PCSK5 is a 93 kDa protein that is composed of 770 amino acid residues. It contains a signal peptide, a propeptide, a catalytic domain, a P domain, and a C-terminal domain. The catalytic domain is essential for the enzymatic activity of PCSK5, while the P domain is involved in substrate recognition. The C-terminal domain is responsible for the localization and stability of the protein.

The structure of Recombinant Human PCSK5 is similar to other members of the proprotein convertase family, with a highly conserved catalytic triad consisting of Asp, His, and Ser residues. This triad is essential for the proteolytic activity of PCSK5 and is located in the catalytic domain.

Activity of Recombinant Human PCSK5

Recombinant Human PCSK5 is a serine protease that cleaves peptide bonds at specific sites within target proteins. It is involved in the processing and activation of various proteins, including growth factors, receptors, and enzymes. This proteolytic activity is crucial for the regulation of numerous biological processes, such as cell proliferation, differentiation, and survival.

One of the main targets of Recombinant Human PCSK5 is the proform of the epidermal growth factor receptor (proEGFR). PCSK5 cleaves proEGFR at a specific site, resulting in the activation of EGFR and the initiation of downstream signaling pathways. This process is essential for cell proliferation and survival, and dysregulation of PCSK5 activity has been linked to various diseases, including cancer.

In addition to its role in the activation of growth factors and receptors, Recombinant Human PCSK5 also plays a crucial role in the regulation of cholesterol metabolism. It is involved in the processing of low-density lipoprotein receptor-related protein 1 (LRP1), which is responsible for the clearance of cholesterol from the bloodstream. Dysregulation of PCSK5 activity has been linked to elevated levels of cholesterol and increased risk of cardiovascular diseases.

Applications of Recombinant Human PCSK5

Recombinant Human PCSK5 has numerous applications in both research and therapeutic settings. Its role in the processing and activation of growth factors and receptors makes it an essential tool for studying various biological processes, such as cell proliferation and differentiation. It is also used in drug discovery and development, as dysregulation of PCSK5 activity has been linked to various diseases, including cancer and cardiovascular diseases.

In therapeutic settings, Recombinant Human PCSK5 has potential as a target for the treatment of various diseases. Inhibitors of PCSK5 have been developed and are currently being tested for their effectiveness in treating cancer and cardiovascular diseases. Additionally, recombinant PCSK5 itself can be used as a potential therapeutic agent for the treatment of diseases that are caused by dysregulation of PCSK5 activity.

Conclusion

In summary, Recombinant Human PCSK5 is a crucial protein involved in the processing and activation of various proteins, including growth factors, receptors, and enzymes. Its structure, activity, and applications make it an essential tool for studying biological processes and a potential target for therapeutic interventions. Further research on this protein and its role in various diseases may lead to the development of new treatments and potential cures

Recombinant Human PCSK5, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PCSK5, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products