Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PCP4 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P48539
Molecular weight:
19.00 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Ser2–Ser62
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PCP4 Protein, N-His-SUMO

Product name ARO-P11237-100
Uniprot ID P48539
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Molecular weight 19.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser62
Aliases /Synonyms PCP4, Calmodulin regulator protein PCP4, Purkinje cell protein 4, Brain-specific polypeptide PEP-19, PEP19
Reference ARO-P11237
Note For research use only.
Molecular Constructor
Ser2–Ser62
Product name ARO-P11237-1MG
Uniprot ID P48539
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Molecular weight 19.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser62
Aliases /Synonyms PCP4, Calmodulin regulator protein PCP4, Purkinje cell protein 4, Brain-specific polypeptide PEP-19, PEP19
Reference ARO-P11237
Note For research use only.
Molecular Constructor
Ser2–Ser62
Product name ARO-P11237-50
Uniprot ID P48539
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
Molecular weight 19.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Ser62
Aliases /Synonyms PCP4, Calmodulin regulator protein PCP4, Purkinje cell protein 4, Brain-specific polypeptide PEP-19, PEP19
Reference ARO-P11237
Note For research use only.
Molecular Constructor
Ser2–Ser62

Introduction

Recombinant Human PCP4 Protein, also known as Purkinje cell protein 4 (PCP4), is a highly conserved protein that plays a crucial role in neuronal development and function. It is a member of the EF-hand calcium-binding protein family and is expressed in various tissues, with the highest levels found in the brain and heart. In this article, we will discuss the structure, activity, and application of Recombinant Human PCP4 Protein.

Structure of Recombinant Human PCP4 Protein

Recombinant Human PCP4 Protein is a 78 amino acid protein with a molecular weight of approximately 9 kDa. It contains two EF-hand calcium-binding motifs, which are responsible for its calcium-binding activity. The protein also has a highly conserved N-terminal domain that is essential for its function.

EF-hand calcium-binding motifs

The EF-hand motifs in Recombinant Human PCP4 Protein are responsible for its calcium-binding activity. These motifs are found in many calcium-binding proteins and are characterized by a helix-loop-helix structure. The first EF-hand motif in PCP4 is located at the N-terminus, while the second one is located at the C-terminus. These motifs are highly conserved and are essential for the protein’s function.

N-terminal domain

The N-terminal domain of Recombinant Human PCP4 Protein is highly conserved and is essential for its function. It contains a nuclear localization signal, which is responsible for its nuclear localization. This domain also interacts with other proteins, such as transcription factors, and is involved in regulating gene expression.

Activity of Recombinant Human PCP4 Protein

Recombinant Human PCP4 Protein is a calcium-binding protein that plays a crucial role in neuronal development and function. It is involved in regulating calcium signaling and is thought to modulate the activity of ion channels and neurotransmitter receptors. PCP4 has also been shown to interact with other proteins, such as calmodulin, and may play a role in modulating their activity.

Regulation of gene expression

Recombinant Human PCP4 Protein has been shown to regulate gene expression by interacting with transcription factors. It can act as a co-activator or co-repressor, depending on the specific transcription factor it interacts with. This activity of PCP4 is thought to be important for neuronal development and function.

Modulation of calcium signaling

As a calcium-binding protein, Recombinant Human PCP4 Protein is involved in regulating calcium signaling in cells. It can modulate the activity of ion channels and neurotransmitter receptors, which are important for neuronal excitability and synaptic transmission. This activity of PCP4 is thought to be crucial for proper neuronal function.

Application of Recombinant Human PCP4 Protein

Recombinant Human PCP4 Protein has various applications in the fields of neuroscience, cardiology, and immunology. Its role in regulating gene expression and calcium signaling makes it a valuable tool for studying neuronal development and function. It has also been implicated in heart disease and may have potential as a therapeutic target. Additionally, PCP4 has been identified as an antigen in autoimmune disorders, making it a potential biomarker for diagnosis and treatment.

Neuroscience research

The role of Recombinant Human PCP4 Protein in neuronal development and function makes it a valuable tool for studying the nervous system. Its ability to regulate gene expression and modulate calcium signaling can provide insights into the mechanisms of neurodegenerative diseases and neurological disorders.

Cardiology

Recombinant Human PCP4 Protein has been implicated in heart disease and may have potential as a therapeutic target. Its role in regulating calcium signaling in the heart makes it a promising candidate for the treatment of heart failure and other cardiovascular diseases.

Immunology

PCP4 has been identified as an antigen in autoimmune

Recombinant Human PCP4 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human PCP4 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products