Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PAF1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N7H5
Molecular weight:
17.82 kDa

Original price was: €245.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Met205–Arg336
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PAF1 Protein, N-His

Product name ARO-P11992-100
Uniprot ID Q8N7H5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRR
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met205-Arg336
Aliases /Synonyms PD2, RNA polymerase II-associated factor 1 homolog, Pancreatic differentiation protein 2, hPAF1, PAF1
Reference ARO-P11992
Note For research use only.
Molecular Constructor
Met205–Arg336
Product name ARO-P11992-1MG
Uniprot ID Q8N7H5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRR
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met205-Arg336
Aliases /Synonyms PD2, RNA polymerase II-associated factor 1 homolog, Pancreatic differentiation protein 2, hPAF1, PAF1
Reference ARO-P11992
Note For research use only.
Molecular Constructor
Met205–Arg336
Product name ARO-P11992-50
Uniprot ID Q8N7H5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRR
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met205-Arg336
Aliases /Synonyms PD2, RNA polymerase II-associated factor 1 homolog, Pancreatic differentiation protein 2, hPAF1, PAF1
Reference ARO-P11992
Note For research use only.
Molecular Constructor
Met205–Arg336

Recombinant Human PAF1 Protein, also known as Polymerase-Associated Factor 1, is a highly conserved protein that plays a crucial role in regulating gene expression. It is a 66 kDa protein that is composed of 600 amino acids and is encoded by the PAF1 gene located on chromosome 19 in humans.

The primary structure of Recombinant Human PAF1 Protein is characterized by the presence of several conserved domains, including the C-terminal domain (CTD) and the PAF1 domain. The CTD is involved in protein-protein interactions and is essential for the recruitment of PAF1 to the RNA polymerase II complex. The PAF1 domain, on the other hand, is responsible for the interaction with other transcription factors and chromatin-modifying enzymes.

In addition to these conserved domains, Recombinant Human PAF1 Protein also contains several functional motifs, such as the WD40 repeat domain and the RNA recognition motif (RRM). These motifs play a critical role in the protein’s activity by mediating interactions with other proteins and RNA molecules.

Activity of Recombinant Human PAF1 Protein

Recombinant Human PAF1 Protein is a key component of the RNA polymerase II complex, which is responsible for transcribing DNA into RNA. It acts as a scaffold protein, bringing together various transcription factors and chromatin-modifying enzymes to regulate gene expression. PAF1 is also involved in the elongation and termination of transcription, as well as in the processing of pre-mRNA.

One of the key functions of Recombinant Human PAF1 Protein is its role in histone modification. PAF1 interacts with the histone methyltransferase SET1/COMPASS complex, which leads to the trimethylation of histone H3 at lysine 4 (H3K4me3). This modification is associated with active gene expression and is crucial for the proper regulation of gene expression.

Moreover, Recombinant Human PAF1 Protein is also involved in the regulation of chromatin structure. It interacts with the histone deacetylase complex NuRD, which is responsible for removing acetyl groups from histones. This interaction leads to the deacetylation of histone H3 and H4, resulting in a more compact chromatin structure that can repress gene expression.

Application of Recombinant Human PAF1 Protein

Recombinant Human PAF1 Protein has various applications in both basic research and biotechnology. Its role in regulating gene expression makes it a valuable tool for studying the mechanisms of transcription and chromatin modification. It has also been implicated in various diseases, such as cancer and neurodegenerative disorders, making it a potential target for therapeutic interventions.

One of the most significant applications of Recombinant Human PAF1 Protein is in the production of recombinant proteins. PAF1 has been shown to enhance the expression of recombinant proteins in various cell types, making it a useful tool for protein production in both academic and industrial settings. Its ability to regulate gene expression also makes it a potential candidate for improving the production of biopharmaceuticals.

Moreover, Recombinant Human PAF1 Protein has been used in the development of novel drug screening assays. Its involvement in various cellular processes, such as transcription and histone modification, makes it a valuable target for drug discovery. PAF1 inhibitors have been shown to have anti-cancer properties, highlighting its potential as a therapeutic target.

In conclusion, Recombinant Human PAF1 Protein is a crucial player in the regulation of gene expression and chromatin modification. Its structure and activity make it a versatile tool for studying transcription and protein production, as well as a potential target for drug development. Further research on this protein is necessary to fully understand its role in cellular processes and its potential applications in biotechnology and medicine.

Recombinant Human PAF1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PAF1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products