Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NKX2-5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52952
Molecular weight:
35.63 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points
Ser146–Gly206
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NKX2-5 Protein, N-GST & C-His

Product name ARO-P12215-100
Uniprot ID P52952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVG
Molecular weight 35.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser146-Gly206
Aliases /Synonyms NKX2E, CSX, Homeobox protein Nkx-2.5, NKX2.5, NKX2-5, Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E
Reference ARO-P12215
Note For research use only.
Molecular Constructor
Ser146–Gly206
Product name ARO-P12215-1MG
Uniprot ID P52952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVG
Molecular weight 35.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser146-Gly206
Aliases /Synonyms NKX2E, CSX, Homeobox protein Nkx-2.5, NKX2.5, NKX2-5, Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E
Reference ARO-P12215
Note For research use only.
Molecular Constructor
Ser146–Gly206
Product name ARO-P12215-50
Uniprot ID P52952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVG
Molecular weight 35.63 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser146-Gly206
Aliases /Synonyms NKX2E, CSX, Homeobox protein Nkx-2.5, NKX2.5, NKX2-5, Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E
Reference ARO-P12215
Note For research use only.
Molecular Constructor
Ser146–Gly206

Introduction to Recombinant Human NKX2-5 Protein

Recombinant Human NKX2-5 Protein, also known as Homeobox protein Nkx-2.5, is a transcription factor that plays a critical role in cardiac development and function. It is encoded by the NKX2-5 gene and is a member of the NK2 family of homeobox proteins.

Structure of Recombinant Human NKX2-5 Protein

The recombinant form of NKX2-5 protein is produced through genetic engineering techniques, where the gene sequence for NKX2-5 is inserted into a host organism such as bacteria or yeast. The resulting protein is a 324 amino acid polypeptide with a molecular weight of approximately 36 kDa.

NKX2-5 protein contains a conserved DNA-binding homeodomain, which is responsible for its role as a transcription factor. This domain allows NKX2-5 to bind to specific DNA sequences and regulate the expression of target genes involved in cardiac development and function.

Activity of Recombinant Human NKX2-5 Protein

Recombinant Human NKX2-5 Protein is a key regulator of cardiac development and function. It is primarily expressed in the developing heart and is essential for proper heart formation and function. Studies have shown that mutations in the NKX2-5 gene can lead to congenital heart defects and cardiac arrhythmias.

NKX2-5 protein functions as a transcription factor by binding to specific DNA sequences and regulating the expression of target genes. It has been found to activate the expression of genes involved in cardiac muscle development, such as myosin heavy chain and cardiac troponin T. It also plays a role in the maintenance of cardiac function by regulating the expression of genes involved in calcium handling and contractility.

In addition to its role in cardiac development and function, NKX2-5 protein has also been shown to have anti-inflammatory properties. It has been found to inhibit the production of inflammatory cytokines and promote the survival of cardiac cells under stress conditions.

Application of Recombinant Human NKX2-5 Protein

Recombinant Human NKX2-5 Protein has a wide range of applications in both research and clinical settings. Its role in cardiac development and function makes it a valuable tool for studying heart development and disease. It has been used in various in vitro and in vivo studies to understand the molecular mechanisms involved in cardiac development and function.

In a clinical setting, NKX2-5 protein has potential therapeutic applications for the treatment of congenital heart defects and cardiac arrhythmias. Mutations in the NKX2-5 gene have been linked to various congenital heart defects, and the use of recombinant NKX2-5 protein may help in correcting these defects.

Furthermore, the anti-inflammatory properties of NKX2-5 protein make it a potential therapeutic agent for the treatment of inflammatory heart diseases, such as myocarditis and heart failure. Its ability to promote the survival of cardiac cells under stress conditions may also have implications for the treatment of heart diseases.

Conclusion

Recombinant Human NKX2-5 Protein is a crucial transcription factor involved in cardiac development and function. Its structure, activity, and applications make it a valuable tool for understanding heart development and disease. Further research on NKX2-5 protein may lead to potential therapeutic interventions for various cardiac conditions.

Recombinant Human NKX2-5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human NKX2-5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products