Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q16649
Molecular weight:
24.83 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Glu65–Ser161
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep

Product name ARO-P12277-100
Uniprot ID Q16649
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSS
Molecular weight 24.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu65-Ser161
Aliases /Synonyms IL3BP1, Nuclear factor interleukin-3-regulated protein, E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, NFIL3, Interleukin-3-binding protein 1, Transcriptional activator NF-IL3A, E4BP4
Reference ARO-P12277
Note For research use only.
Molecular Constructor
Glu65–Ser161
Product name ARO-P12277-1MG
Uniprot ID Q16649
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSS
Molecular weight 24.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu65-Ser161
Aliases /Synonyms IL3BP1, Nuclear factor interleukin-3-regulated protein, E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, NFIL3, Interleukin-3-binding protein 1, Transcriptional activator NF-IL3A, E4BP4
Reference ARO-P12277
Note For research use only.
Molecular Constructor
Glu65–Ser161
Product name ARO-P12277-50
Uniprot ID Q16649
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSS
Molecular weight 24.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu65-Ser161
Aliases /Synonyms IL3BP1, Nuclear factor interleukin-3-regulated protein, E4 promoter-binding protein 4, Interleukin-3 promoter transcriptional activator, NFIL3, Interleukin-3-binding protein 1, Transcriptional activator NF-IL3A, E4BP4
Reference ARO-P12277
Note For research use only.
Molecular Constructor
Glu65–Ser161

Introduction to Recombinant Human NFIL3 Protein

Recombinant Human NFIL3 Protein, also known as Nuclear Factor Interleukin-3 Regulated Protein (NFIL3), is a protein that plays a crucial role in regulating gene expression and cell growth. It is produced through recombinant DNA technology, making it a highly pure and specific protein for various scientific applications. In this article, we will explore the structure, activity, and applications of Recombinant Human NFIL3 Protein.

Structure of Recombinant Human NFIL3 Protein

Recombinant Human NFIL3 Protein is a transcription factor that belongs to the basic leucine zipper (bZIP) family. It is composed of 676 amino acids and has a molecular weight of approximately 75 kDa. The protein contains a DNA-binding domain, a leucine zipper domain, and a transactivation domain. The DNA-binding domain allows NFIL3 to bind to specific DNA sequences, while the leucine zipper domain is responsible for dimerization with other proteins. The transactivation domain is crucial for activating the expression of target genes.

Activity of Recombinant Human NFIL3 Protein

Recombinant Human NFIL3 Protein is a transcription factor that regulates the expression of various genes involved in cell growth, differentiation, and apoptosis. It binds to specific DNA sequences known as NFIL3 response elements (NREs) and activates or represses the transcription of target genes. NFIL3 is known to interact with other proteins and form heterodimers, which further enhances its transcriptional activity.

NFIL3 is also involved in regulating the immune response by controlling the production of cytokines, such as interleukin-3 (IL-3) and granulocyte-macrophage colony-stimulating factor (GM-CSF). These cytokines play a crucial role in the development and function of immune cells, making NFIL3 an essential protein in the immune system.

Moreover, NFIL3 has been found to play a role in maintaining the balance between cell proliferation and apoptosis. It can promote cell proliferation by activating the expression of genes involved in cell cycle progression, while also inducing cell death by repressing the expression of anti-apoptotic genes. This dual role of NFIL3 makes it a critical regulator of cell growth and survival.

Applications of Recombinant Human NFIL3 Protein

Recombinant Human NFIL3 Protein has various applications in the field of research and medicine. It is commonly used as an antigen in studies related to the immune system and cancer. NFIL3 has been found to be overexpressed in certain types of cancer, and its inhibition has shown promising results in suppressing tumor growth. Researchers also use recombinant NFIL3 to study the role of this protein in immune cell development and function.

Moreover, NFIL3 is a potential target for drug development, as its dysregulation has been linked to various diseases, including autoimmune disorders, inflammation, and neurological disorders. By understanding the structure and activity of NFIL3, scientists can design drugs that specifically target this protein and treat these diseases effectively.

In addition, recombinant NFIL3 is also used in gene therapy studies. By introducing the NFIL3 gene into cells, researchers can manipulate its activity and regulate the expression of target genes. This technique has shown promising results in treating genetic disorders and other diseases caused by gene mutations.

Conclusion

In summary, Recombinant Human NFIL3 Protein is a crucial protein involved in regulating gene expression and cell growth. Its structure and activity make it an essential player in various biological processes, including immune response, cell proliferation, and apoptosis. With its diverse applications in research and medicine, NFIL3 continues to be a subject of interest for scientists, and further studies on this protein will provide valuable insights into its role in health and disease.

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products