Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95139
Molecular weight:
21.86 kDa

Original price was: €251.00.Current price is: €193.00.

50ug 23% OFF + 193 loyalty points
Thr2–Ser68
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep

Product name ARO-P11842-100
Uniprot ID O95139
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKS
Molecular weight 21.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser68
Aliases /Synonyms NDUFB6, NADH-ubiquinone oxidoreductase B17 subunit, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17
Reference ARO-P11842
Note For research use only.
Molecular Constructor
Thr2–Ser68
Product name ARO-P11842-1MG
Uniprot ID O95139
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKS
Molecular weight 21.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser68
Aliases /Synonyms NDUFB6, NADH-ubiquinone oxidoreductase B17 subunit, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17
Reference ARO-P11842
Note For research use only.
Molecular Constructor
Thr2–Ser68
Product name ARO-P11842-50
Uniprot ID O95139
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKS
Molecular weight 21.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Ser68
Aliases /Synonyms NDUFB6, NADH-ubiquinone oxidoreductase B17 subunit, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, Complex I-B17, CI-B17
Reference ARO-P11842
Note For research use only.
Molecular Constructor
Thr2–Ser68

Introduction

Recombinant Human NDUFB6 Protein is a type of protein that is produced through genetic engineering techniques. It is a recombinant protein, meaning it is created by combining DNA from different sources to produce a specific protein. This process allows for the production of large quantities of a specific protein, which can then be used for various scientific and medical purposes.

Structure of Recombinant Human NDUFB6 Protein

The structure of Recombinant Human NDUFB6 Protein is composed of 183 amino acids and has a molecular weight of 20.9 kDa. It consists of two main domains, an N-terminal domain and a C-terminal domain. The N-terminal domain is responsible for binding to other proteins, while the C-terminal domain is involved in the catalytic activity of the protein.

Activity of Recombinant Human NDUFB6 Protein

Recombinant Human NDUFB6 Protein is a subunit of the mitochondrial respiratory chain complex I. This complex is responsible for the first step in the process of cellular respiration, which is the production of ATP (adenosine triphosphate) from glucose. The NDUFB6 subunit plays a crucial role in the function and stability of complex I, as it is involved in the transfer of electrons during the process of ATP production.

Furthermore, studies have shown that Recombinant Human NDUFB6 Protein also has a role in regulating the production of reactive oxygen species (ROS) in the mitochondria. ROS are natural byproducts of cellular respiration, but excessive production can lead to oxidative stress and damage to cells. Recombinant Human NDUFB6 Protein helps to maintain the balance of ROS production, thus protecting cells from oxidative damage.

Application of Recombinant Human NDUFB6 Protein

Recombinant Human NDUFB6 Protein has various applications in the field of research and medicine. One of its main applications is in the study of mitochondrial diseases. Mutations in the genes encoding for complex I subunits, including NDUFB6, have been linked to various mitochondrial disorders. Recombinant Human NDUFB6 Protein can be used to study the function and activity of complex I, and its role in the development of these diseases.

Moreover, Recombinant Human NDUFB6 Protein has potential therapeutic applications. As it plays a critical role in the production of ATP, it can be used in the treatment of disorders that involve mitochondrial dysfunction, such as neurodegenerative diseases and metabolic disorders. Additionally, its ability to regulate ROS production makes it a potential candidate for the treatment of conditions related to oxidative stress, such as cardiovascular diseases and cancer.

Conclusion

In conclusion, Recombinant Human NDUFB6 Protein is a vital protein in the mitochondrial respiratory chain complex I. Its structure and activity make it an essential component in the production of ATP and regulation of ROS. Its applications in research and medicine make it a valuable tool in the study and treatment of various diseases. Further research on Recombinant Human NDUFB6 Protein may lead to new insights and potential therapeutic interventions in the future.

Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human NDUFB6 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products