Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NDUFA13 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9P0J0
Molecular weight:
24.90 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Met51–Thr144
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NDUFA13 Protein, N-His-SUMO & C-Strep

Product name ARO-P11773-100
Uniprot ID Q9P0J0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Molecular weight 24.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met51-Thr144
Aliases /Synonyms Gene associated with retinoic and IFN-induced mortality 19 protein, Gene associated with retinoic and interferon-induced mortality 19 protein, CI-B16.6, Cell death regulatory protein GRIM-19, NADH-ubiquinone oxidoreductase B16.6 subunit, GRIM-19, Complex I-B16.6, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, GRIM19, NDUFA13
Reference ARO-P11773
Note For research use only.
Molecular Constructor
Met51–Thr144
Product name ARO-P11773-1MG
Uniprot ID Q9P0J0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Molecular weight 24.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met51-Thr144
Aliases /Synonyms Gene associated with retinoic and IFN-induced mortality 19 protein, Gene associated with retinoic and interferon-induced mortality 19 protein, CI-B16.6, Cell death regulatory protein GRIM-19, NADH-ubiquinone oxidoreductase B16.6 subunit, GRIM-19, Complex I-B16.6, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, GRIM19, NDUFA13
Reference ARO-P11773
Note For research use only.
Molecular Constructor
Met51–Thr144
Product name ARO-P11773-50
Uniprot ID Q9P0J0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Molecular weight 24.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met51-Thr144
Aliases /Synonyms Gene associated with retinoic and IFN-induced mortality 19 protein, Gene associated with retinoic and interferon-induced mortality 19 protein, CI-B16.6, Cell death regulatory protein GRIM-19, NADH-ubiquinone oxidoreductase B16.6 subunit, GRIM-19, Complex I-B16.6, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, GRIM19, NDUFA13
Reference ARO-P11773
Note For research use only.
Molecular Constructor
Met51–Thr144

Recombinant Human NDUFA13 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human NDUFA13 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products