Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NDNF, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TB73
Molecular weight:
37.44 kDa

Original price was: €271.00.Current price is: €230.00.

50ug 15% OFF + 230 loyalty points
Met238–Phe331
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NDNF, N-GST

Product name ARO-P13229-100
Uniprot ID Q8TB73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTF
Molecular weight 37.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met238-Phe331
Aliases /Synonyms NDNF, C4orf31, Protein NDNF, Neuron-derived neurotrophic factor
Reference ARO-P13229
Note For research use only.
Molecular Constructor
Met238–Phe331
Product name ARO-P13229-1MG
Uniprot ID Q8TB73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTF
Molecular weight 37.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met238-Phe331
Aliases /Synonyms NDNF, C4orf31, Protein NDNF, Neuron-derived neurotrophic factor
Reference ARO-P13229
Note For research use only.
Molecular Constructor
Met238–Phe331
Product name ARO-P13229-50
Uniprot ID Q8TB73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFVVNINSNMSTAYVGTF
Molecular weight 37.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met238-Phe331
Aliases /Synonyms NDNF, C4orf31, Protein NDNF, Neuron-derived neurotrophic factor
Reference ARO-P13229
Note For research use only.
Molecular Constructor
Met238–Phe331

Introduction

Recombinant Human NDNF (Neuron-Derived Neurotrophic Factor) is a protein that plays a crucial role in the development and maintenance of the nervous system. This protein is produced through recombinant DNA technology, which involves combining DNA from different sources to create a new genetic sequence. Recombinant Human NDNF has been extensively studied and has shown promising potential in various applications related to neurodegenerative diseases and nerve regeneration.

Structure of Recombinant Human NDNF

Recombinant Human NDNF is a homodimeric protein, meaning it is composed of two identical subunits. Each subunit consists of 132 amino acids and has a molecular weight of approximately 14.8 kDa. The amino acid sequence of Recombinant Human NDNF is highly conserved across different species, indicating its importance in biological functions.

The three-dimensional structure of Recombinant Human NDNF has been determined through X-ray crystallography. It has a unique fold, with a central beta-sheet surrounded by alpha-helices. This structure is essential for the protein’s stability and its ability to interact with other molecules.

Activity of Recombinant Human NDNF

Recombinant Human NDNF is a potent neurotrophic factor, meaning it promotes the growth, survival, and differentiation of neurons. It exerts its effects by binding to specific receptors on the surface of nerve cells, including TrkB and TrkC. This binding activates various signaling pathways, such as the PI3K/Akt and MAPK/ERK pathways, which are crucial for neuronal development and function.

Studies have also shown that Recombinant Human NDNF can protect neurons from damage and promote their regeneration. This activity has been observed in various models of neurodegenerative diseases, such as Parkinson’s and Alzheimer’s disease. Recombinant Human NDNF has also been shown to enhance the survival and function of dopaminergic neurons, which are affected in Parkinson’s disease.

Application of Recombinant Human NDNF

Recombinant Human NDNF has a wide range of potential applications in the field of neuroscience. One of the most promising uses of this protein is in the treatment of neurodegenerative diseases. Its ability to promote neuronal survival and regeneration makes it a potential therapeutic agent for conditions such as Parkinson’s, Alzheimer’s, and Huntington’s disease.

Recombinant Human NDNF has also been studied for its potential in nerve regeneration. Injuries to the nervous system, such as spinal cord injuries, can result in permanent damage and loss of function. Recombinant Human NDNF has been shown to promote the growth of nerve cells and improve functional recovery in animal models of nerve injury.

Furthermore, Recombinant Human NDNF has been investigated for its role in psychiatric disorders. Studies have shown that this protein may have antidepressant and anxiolytic effects, making it a potential treatment for mental health conditions.

Conclusion

Recombinant Human NDNF is a crucial protein in the development and maintenance of the nervous system. Its unique structure and potent neurotrophic activity make it a promising candidate for various applications related to neurodegenerative diseases and nerve regeneration. Further research and clinical trials are needed to fully understand the potential of this protein and its role in treating neurological disorders.

Recombinant Human NDNF, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human NDNF, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products